Recombinant Human Beta-Nerve Growth Factor (NGF), Active

Name: Recombinant Human Beta-Nerve Growth Factor (NGF), Active
Brand: Beta LifeScience
SKU: BLC-05952P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Beta-Nerve Growth Factor (NGF), Active is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 2 ng/ml.
Uniprotkb	P01138
Target Symbol	NGF
Synonyms	Beta nerve growth factor; Beta NGF; Beta-nerve growth factor; Beta-NGF; HSAN5; MGC161426; MGC161428; Nerve growth factor (beta polypeptide); Nerve growth factor; Nerve growth factor beta; Nerve growth factor beta polypeptide; Nerve growth factor beta subunit; NGF; NGF_HUMAN; NGFB; NID67
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	Tag-Free
Complete Sequence	SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Expression Range	122-241aa
Protein Length	Full Length of Mature Protein
Mol. Weight	13.4 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS,pH 7.4
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function	Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival (Probable). The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form.
Subcellular Location	Secreted. Endosome lumen.
Protein Families	NGF-beta family
Database References	HGNC: 7808 OMIM: 162030 KEGG: hsa:4803 STRING: 9606.ENSP00000358525 UniGene: PMID: 29527653 Single nucleotide polymorphisms in NGF gene (rs6330) and NGFR gene (rs2072446 and rs734194) are associated with ischemic stroke. The NGF rs6330T and NGFR rs2072446T minor alleles might be nominated as a risk factor for developing ischemic stroke and NGFR rs734194*G minor allele as a protective against this disease at least in Armenian population PMID: 29499660 Neurotrophic factors and hippocampal activity in PTSD PMID: 29799860 SNRPA may contribute to GC progression via NGF and could be a prognostic biomarker for GC. PMID: 30039889 Results show that NGF signalling is strongly linked to pathological and regenerative processes in human teeth. PMID: 28465581 The results suggest an interaction between NGF, GDNF and MMP-9 during the transition to malignancy in prostate cancer (PC). Also this interaction may involve in regulating PC cell differentiation, tumor invasion, progression, and the agressiveness of PC. PMID: 28237042 the anti-tumor activity of oleuropein against hepatocellular carcinoma could be attributed to influencing the pro-NGF/NGF balance via affecting MMP-7 activity without affecting the gene expression of NGF PMID: 29476769 co-expression patterns of NGF and heme oxygenase-1 might be used as prognostic indicators for gastric carcinoma patients PMID: 28679437 This review will briefly address the peripheral and central sensitization mechanisms of airway neurons and will then focus on NGF signaling and its role in cough hypersensitivity.[review] PMID: 28494216 First-trimester plasma nerve growth factor is lower in patients who subsequently develop preeclampsia. PMID: 27513943 This study show evidence of variation in plasmatic beta-NGF expression during the progression of dementia. PMID: 27802234 NGF is functionally linked to beta-catenin, promoting the migration of human ovarian cancer cells via the WNT/beta-catenin pathway. PMID: 27835587 Varicella zoster virus DNA replication is regulated in part by an NGF pathway that is PI3-kinase-independent. PMID: 27683235 Many studies indicate that the only presence of NGF is unable to generate cell carcinogenesis, both in normal neuronal and non-neuronal cells/tissues. However, it cannot be excluded the possibility that the co-expression of NGF and pro-carcinogenic molecules might open to different consequence. [review] PMID: 27439311 the effect and underlying mechanisms of NGF/BDNF on the production of NPW in PC12 cells and hypothalamus, is reported. PMID: 28249734 These data support a role for islet NGF in fine-tuning insulin secretion. PMID: 27424144 The results of this study indicated that dysmenorrhea pain severity is partly genetically determined by the chromosome 1p13.2, near the nerve growth factor locu. PMID: 27454463 Findings suggest that IL-1beta and TNF-alpha regulate Nerve Growth Factor expression and production in synovial macrophages and fibroblasts in osteoarthritic joints. PMID: 28677145 These results advance our knowledge of the conformational properties of proNGF and NGF and help provide a rationale for the diverse biological effects of NGF and proNGF at the molecular level. PMID: 28798232 The results of this study suggest that proNGF protein levels may augment the diagnostic accuracy of currently used CSF biomarker panels. PMID: 26825093 Neuroimmune-endocrine events may lead to overactivity of sympathetic nervous system that triggers cascade of pathologic conditions in ovary in polycystic ovary syndrome (PCOS). Data suggest women with PCOS exhibit reduction of CRH and NGF; reduction of CRH/NGF may be under influence of sympathetic nervous system and may reflect deficit of neuronal stress-adaptation in PCOS patients. (CRH = corticotropin releasing hormone) PMID: 27908212 The rare nerve growth factor-beta (NGFB) mutation R221W causes a selective loss of thinly myelinated fibers and especially unmyelinated C-fibers. Carriers of this mutation show altered pain sensation. PMID: 27146986 NGF expression was positively correlated with disease severity and visceral hypersensitivity in irritable bowel syndrome patients. PMID: 27862119 a stage-related modulation of beta-NGF and its receptors in the inflammatory process of OA PMID: 28253191 BDNF and NGF serum levels are reduced in the early and moderate glaucoma stages, suggesting the possibility that both factors could be further investigated as potential circulating biomarkers for the early detection of glaucoma. PMID: 28068360 overexpression of ARMS blocked NGF-mediated secretion, without affecting basal secretion, a decrease in ARMS resulted in potentiation. Similar effects were observed with synembryn-B, a protein that interacts directly with ARMS. Downstream of ARMS and synembryn-B are Galphaq and Trio proteins, which modulate the activity of Rac1 in response to NGF PMID: 26966186 Data show that the standardized nerve growth factor (NGF) concentration was negatively correlated with continuous pain, neuropathic pain and total score, and the standardized S100 proteins S100A8/A9 concentration was positively correlated with present pain intensity and continuous pain. PMID: 27936243 Results indicate that NGF inhibited CRT translocation induced by mitoxantrone. NGF effect on CRT translocation could have consequences in immunotherapy, potentially lessening the effectiveness of this type of treatment. PMID: 28260038 NGF stimulates generation of neurons, but not neuronal progenitors from embryonic stem cells and affects the proportion of specific types of neurons in cultures of differentiating embryonic stem cells. PMID: 28364186 NGF attenuates these responses-both in vivo and in vitro. Therefore, NGF therapy may represent a novel approach for the management of diabetic keratopathy. PMID: 27978558 NGF signaling pathway provides a potential target for developing molecularly targeted therapies PMID: 27792755 these data suggest a positive feedback loop through which NGF-mediated upregulation of p75(NTR) can contribute to the chemo-resistance of Triple negative breast cancer cells. PMID: 27577679 Based on these current developments, the present review provides not only a broad overview of the biological effects of NGF-TrkA-p75NTR on cancer cells and their microenvironment, but also explains why NGF and its receptors are going to evoke major interest as promising therapeutic anti-cancer targets in the coming decade. PMID: 27264679 NGF/CD133 might be an effective and potent therapeutic target for pancreatic cancer metastasis, particularly in perineural invasion PMID: 27654574 The analysis of covariance (ANCOVA) indicated that the mean serum GDNF and NTF3 levels of ADHD patients were significantly higher than that of controls. However, serum BDNF and NGF levels did not show any significant differences between groups. PMID: 27561780 All patients had serum neurotrophin (NT-3, BDNF, NGF) concentrations determined. PMID: 27367919 Serum NGF does not differentiate between recurrent acute pancreatitis and chronic pancreatitis. PMID: 27020638 NGF FLIPs TrkA onto the death TRAIL in neuroblastoma cells PMID: 26962689 Major depression patients had similar serum NGF to controls. PMID: 27008247 data demonstrate the involvement and modulation of nerve growth factor and its receptors in chronic obstructive pulmonary disease and in its staging PMID: 26408608 The present study showed that IL-17, in addition to stimulating an inflammatory response, negatively regulates the action of NGF and NGF R in the polar forms of the leprosy. PMID: 26616164 Locally increased estrogen levels and inflammation may cause increased NGF production in the uterus of patients with adenomyosis. PMID: 25519715 The present study is the first to thoroughly assess the enhancement of neural differentiation of bone marrow mesenchymal stem cells following transfection with bFGF and NGF. PMID: 26572749 Data suggest MMP7 (matrix metalloproteinase 7) in follicular fluid cleaves proNGF (pro-nerve growth factor) in ovarian follicle; both MMP7 and proNGF appear to be products of granulosa cells; processing of proNGF to NGF appears to regulate apoptosis. PMID: 26457789 NGF promotes renal fibrosis via TGF-beta1-signaling activation, suggesting that in kidney diseases high NGF serum levels could contribute to worsen renal fibrosis. PMID: 26066770 This study suggests that the circadian rhythm in the esophagus may be important for the mediation of and/or the response to erosive damage in GERD patients. PMID: 26337663 Intratumoral nerve growth factor expression is not associated with perineural invasion in patients with resected extrahepatic cholangiocarcinoma. PMID: 26547754 NGF has a role in modulating trkANGFR/p75NTR in alphaSMA-expressing conjunctival fibroblasts from human ocular cicatricial pemphigoid PMID: 26569118 NGF-induced tyrosine kinase independent TrkA signaling through CD44 is sufficient to maintain tumor aggressiveness in breast cancer PMID: 25840418 Urinary NGF, but not BDNF, levels decreased significantly after hyaluronic acid therapy. PMID: 24614892

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.