Recombinant Human Bcl-2-Like Protein 11 (BCL2L11) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09133P

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) BCL2L11.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) BCL2L11.
Recombinant Human Bcl-2-Like Protein 11 (BCL2L11) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09133P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Bcl-2-Like Protein 11 (BCL2L11) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O43521 |
Target Symbol | BCL2L11 |
Synonyms | BCL2 like 11 ; B2L11_HUMAN; BAM; Bcl 2 interacting protein Bim; Bcl 2 related ovarian death agonist; Bcl-2-like protein 11; BCL2 interacting mediator of cell death ; BCL2 like 11 (apoptosis facilitator); BCL2 like protein 11 ; Bcl2-interacting mediator of cell death; Bcl2-L-11; Bcl2l11; BIM alpha6; BIM; BIM beta6; BIM beta7; BimEL; BimL; BOD |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH |
Expression Range | 1-198aa |
Protein Length | Full Length |
Mol. Weight | 38.2kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis. |
Subcellular Location | Endomembrane system; Peripheral membrane protein.; [Isoform BimEL]: Mitochondrion. Note=Translocates from microtubules to mitochondria on loss of cell adherence.; [Isoform BimL]: Mitochondrion.; [Isoform BimS]: Mitochondrion.; [Isoform Bim-alpha1]: Mitochondrion. |
Protein Families | Bcl-2 family |
Database References | HGNC: 994 OMIM: 603827 KEGG: hsa:10018 STRING: 9606.ENSP00000376943 UniGene: PMID: 29573636 |