Recombinant Human Basigin (BSG) Protein (His)

Name: Recombinant Human Basigin (BSG) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08315P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cluster of differentiation (cd) proteins, Featured cd protein molecules, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Basigin (BSG) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P35613
Target Symbol	BSG
Synonyms	5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group); Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; Leukocyte activation antigen M6; M 6; M6; M6 leukocyte activation antigen; Neurothelin; OK; OK blood group; OK blood group antigen; TCSF; Tumor cell derived collagenase stimulatory factor; Tumor cell-derived collagenase stimulatory factor
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
Expression Range	138-321aa
Protein Length	Partial
Mol. Weight	24.2kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Essential for normal retinal maturation and development. Acts as a retinal cell surface receptor for NXNL1 and plays an important role in NXNL1-mediated survival of retinal cone photoreceptors. In association with glucose transporter SLC16A1/GLUT1 and NXNL1, promotes retinal cone survival by enhancing aerobic glycolysis and accelerating the entry of glucose into photoreceptors. May act as a potent stimulator of IL6 secretion in multiple cell lines that include monocytes.; Signaling receptor for cyclophilins, essential for PPIA/CYPA and PPIB/CYPB-dependent signaling related to chemotaxis and adhesion of immune cells. Plays an important role in targeting monocarboxylate transporters SLC16A1/GLUT1, SLC16A11 and SLC16A12 to the plasma membrane. Acts as a coreceptor for vascular endothelial growth factor receptor 2 (KDR/VEGFR2) in endothelial cells enhancing its VEGFA-mediated activation and downstream signaling. Promotes angiogenesis through EPAS1/HIF2A-mediated up-regulation of VEGFA (isoform VEGF-165 and VEGF-121) and KDR/VEGFR2 in endothelial cells. Plays a key role in regulating tumor growth, invasion, metastasis and neoangiogenesis by stimulating the production and release of extracellular matrix metalloproteinases and KDR/VEGFR2 by both tumor cells and stromal cells (fibroblasts and endothelial cells).; (Microbial infection) Erythrocyte receptor for P.falciparum RH5 which is essential for erythrocyte invasion by the merozoite stage of P.falciparum isolates 3D7 and Dd2.; (Microbial infection) Erythrocyte receptor for P.falciparum RH5 which is essential for erythrocyte invasion by the merozoite stage of P.falciparum isolates 3D7, Dd2, 7G8 and HB3. Binding of P.falciparum RH5 results in BSG dimerization which triggers an increase in intracellular Ca(2+) in the erythrocyte. This essential step leads to a rearrangement of the erythrocyte cytoskeleton required for the merozoite invasion.; (Microbial infection) Can facilitate human SARS coronavirus (SARS-CoV-1) infection via its interaction with virus-associated PPIA/CYPA.; (Microbial infection) Can facilitate HIV-1 infection via its interaction with virus-associated PPIA/CYPA.; (Microbial infection) First described as a receptor for severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), it is not required for SARS-CoV-2 infection.; (Microbial infection) Acts as a receptor for measles virus.; (Microbial infection) Promotes entry of pentamer-expressing human cytomegalovirus (HCMV) into epithelial and endothelial cells.
Subcellular Location	Melanosome.; [Isoform 1]: Cell membrane; Single-pass type I membrane protein. Photoreceptor inner segment. Cell projection, cilium, photoreceptor outer segment.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein. Endosome. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Basolateral cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell membrane; Single-pass type I membrane protein.; [Isoform 4]: Cell membrane; Single-pass type I membrane protein.
Database References	HGNC: 1116 OMIM: 109480 KEGG: hsa:682 STRING: 9606.ENSP00000333769 UniGene: PMID: 29356040 CD147 and the beta2-adrenergic receptor form hetero-oligomeric complexes.Actinin-4 directly binds to the cytosolic tail of CD147 and governs the assembly of CD147-beta2-adrenergic receptor complexes in highly ordered clusters at bacterial adhesion sites. PMID: 28569760 Plasma sCD147 levels are elevated in breast cancer patients. Soluble CD147 is also associated with tumour size, lymph node metastasis, high recurrent risk, and chemoresistance. PMID: 29807951 overexpression of CD147 may promote OSF progression. PMID: 29457855 these findings show that CD147 is a novel and key mediator of IL-22-induced psoriatic alterations in the epidermis and might be a therapeutic target in patients with psoriasis. PMID: 28272440 Data indicate that CD147 promotes breast cancer cell proliferation, metastasis, and invasion by modulating matrix metalloproteinase 9 (MMP-9) and vascular endothelial growth factor (VEGF) expression. PMID: 29901696 BSG expression is indicative of a poor prognosis in pulmonary adenocarcinoma PMID: 29431238 CD147 expression was associated with clinicopathological features and biomarkers related to triple-negative breast cancer, particularly basal-like breast cancer. PMID: 30099407 Characterization of the role of CD147 in the development of tumors should lead to a better understanding of the changes occurring at the molecular level during the development and progression of primary human bone cancer. PMID: 30043854 Results find CD147 expression level increased in colorectal cancer (CRC) tumors and cell lines and inversely correlated with mir-485 expression. Also, CD147 is a target gene of miR485 which negatively regulates its gene expression. PMID: 29532886 Our results indicate that concomitant stimulation and colocalization of galectin-3 with CD147 are associated with increased gelatinolytic activity in the actively ulcerating human cornea PMID: 29340650 These findings reveal an important cytomegalovirus mechanism for evading antiviral innate immunity through its encoded microRNA US25-1-5p by targeting transmembrane glycoprotein CD147. PMID: 29194430 on a major part of fibroblastic cells in encapsulating peritoneal sclerosis PMID: 28551820 Review: Bsg is an extracellular receptor for CyPA that promotes cell proliferation and inflammation. Thus, the CyPA/Bsg system is potentially a novel therapeutic target for cardiovascular diseases. PMID: 28993547 protein-protein interaction studies on TRAF6 and BSG to get molecular level insights of the reactions. PMID: 28612997 results showed that the rs4919862 SNP of CD147 was closely associated with carotid atherosclerotic plaques formation; thus, polymorphisms of the CD147 gene may be related to the tendency for carotid atherosclerotic plaques PMID: 28582638 Results indicated that higher expression of CD147/EMMPRIN potentially may be a prognostic marker for most cancers. CD147/EMMPRIN overexpression predicted a high risk for chemotherapy drugs resistance. CD147/EMMPRIN is a central player in tumor progression and predicts a poor prognosis. [review] PMID: 27608940 BSG mutation is associated with early-onset high myopia. PMID: 28373534 Cancer cells and fibroblasts interaction promotes breast cancer cells showing stem-like cell properties through up-regulation of EMMPRIN. PMID: 27325313 Cholesterol depletion inhibits the endocytosis of CD147 but that the constitutive shedding of CD147 mediated by ADAM10 is enhanced. PMID: 28703811 Overexpression of CD147 support the metabolic reprograming in papillary renal cell carcinoma PMID: 28028797 This research found that CD147 is correlated with aggressiveness of the glioma, tumor grades, tumor size, necrosis, overall survival, and recurrence rate. PMID: 28560663 Upregulation of CD147 Promotes Metastasis of Cholangiocarcinoma by Modulating the Epithelial-to-Mesenchymal Transitional Process PMID: 28244853 Our retrospective analysis demonstrated CD147 protein expression was significantly associated with clinical N stage, and tumor stage. Meanwhile, it can also serve as an independent prognosis biomarker. PMID: 28427166 miR-492 may be involved in the regulation of OK antigen expression on red blood cells with the BSG rs8259 TT genotype. PMID: 28981932 Our findings show that emmprin is released through microvesicle shedding in sarcoma cells, and emmprin in microvesicles regulates MMP-2 production by influencing the activity of fibroblasts located at sites distant from the tumor cells. PMID: 28498412 enhancement of the effect of trastuzumab on HER2-positive cells following CD147 knockdown might be attributed to increased apoptosis and decreased phosphorylation of signaling proteins PMID: 27363028 this study shows that CD147 silencing inhibits tumor growth by suppressing glucose transport in melanoma PMID: 27556188 Fucosylation of CD147 by Lewis y antigen enhanced the survival ability by promoting basic autophagy activity and restraining autophagic cell death in ovarian cancer. PMID: 27863372 Review/Meta-analysis: up-regulation of CD147 was effectively predictive of worse prognosis in gastrointestinal cancer. PMID: 27768590 Suggest a central role for CD147 in pancreatic cancer metabolic reprogramming, particularly with respect to amino acid anabolism and calcium signaling. PMID: 28039486 combined CA9-/CD147-capture antibodies demonstrated high efficiency for capturing circulating renal cell carcinoma cells PMID: 27494883 important factor in the aggressive behaviour of melanoma PMID: 27060463 Xkr8-BSG/NPTN complex is required for phosphatidylserine scrambling in apoptotic cell membranes. PMID: 27503893 Our study provides new evidence that interaction of KLF6 and Sp1 regulates basigin-2 expression in hepatocellular carcinoma PMID: 27057625 EMMPRIN/MMPs/VEGF pathway is involved in PDR angiogenesis. PMID: 27860331 study identified novel interactions between CD147 and RING1, recovered CD147 nuclear envelope distribution in melanoma cells, and suggested a new mechanism underlying how cytoplasmic CD147 promotes melanoma development PMID: 28832687 Immunohistochemistry was employed to analyze cFos, cJun and CD147 expression in 41 UCB cases and 34 noncancerous human bladder tissues. PMID: 28358415 High BSG expression is associated with multiple myeloma. PMID: 28017969 report that a phosphoserine (pSer) in CD147 (pSer252) is responsible for this interaction and inhibition of the Smad4/p21(WAF1) signal that promotes cell proliferation PMID: 28684116 findings indicate that Rab22a enhances recycling of CD147, which is required for lung cancer cell migration and invasion,and targeting CD147 recycling may be a rational strategy for lung cancer therapy PMID: 28433697 Studied expression of CD147 in both ALK+ and ALK- anaplastic large-cell lymphoma; found CD147 to be a downstream target for activation by C/EBPbeta. PMID: 28581487 this studies identify potential signaling routes of CD147 affecting T cell growth and function PMID: 28148733 Our results highlight the important role of the TGF-beta1-CD147 self-sustaining network in driving HCC development by regulating differentiation plasticity, which provides a strong basis for further investigations of the differentiation therapy of HCC targeting TGF-beta1 and CD147. PMID: 27041581 rs8259 polymorphism failed to exhibit an association with cardiovascular mortality (p = 0.283). BSG rs8259 polymorphism may contribute to decreased risk of Chronic Heart Failure in a Chinese Han population PMID: 28230811 This study suggests that CD44 and CD147 together improve the prognostic efficacy of tumor differentiation; in vitro results further point out that these markers might be determinant of differentiation characteristics, imparting properties of increased self-renewal, migration, and invasion. PMID: 28631562 Results suggest that CD147 promotes chemoresistance by activating MAPK/ERK signaling pathway in head and neck squamous cell carcinoma (HNSCC). PMID: 28062212 PvTRAg38 binds to two erythrocyte receptors basigin and band 3 through P2 and P4 regions, respectively, to facilitate parasite growth. PMID: 27881677 phosphatidylinositol 3-kinase/Akt pathway may be the probable signaling pathway underlying CD147 induced up-regulation of VEGF in U937-derived foam cells PMID: 27619643 D147 expression is potentially closely related to Hepatocellular Carcinoma survival and associated clinicopathological parameters, paving the way for further research PMID: 28386553

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.