Recombinant Human Atypical Chemokine Receptor 3 (ACKR3) Protein (His-SUMO)

Name: Recombinant Human Atypical Chemokine Receptor 3 (ACKR3) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09420P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Atypical Chemokine Receptor 3 (ACKR3) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P25106
Target Symbol	ACKR3
Synonyms	ACKR3; CMKOR1; CXCR7; GPR159; RDC1; Atypical chemokine receptor 3; C-X-C chemokine receptor type 7; CXC-R7; CXCR-7; Chemokine orphan receptor 1; G-protein coupled receptor 159; G-protein coupled receptor RDC1 homolog; RDC-1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK
Expression Range	1-40aa
Protein Length	Partial
Mol. Weight	20.5kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CXCL11 and CXCL12/SDF1. Chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development. Acts as coreceptor with CXCR4 for a restricted number of HIV isolates.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region. Early endosome. Recycling endosome. Note=Predominantly localizes to endocytic vesicles, and upon stimulation by the ligand is internalized via clathrin-coated pits in a beta-arrestin-dependent manner. Once internalized, the ligand dissociates from the receptor, and is targeted to degradation while the receptor is recycled back to the cell membrane.
Protein Families	G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Database References	HGNC: 23692 OMIM: 610376 KEGG: hsa:57007 STRING: 9606.ENSP00000272928 UniGene: PMID: 29433559 Expression of CXCR7 associates with increased survival in CXCR4+ but not in CXCR4- DLBCL patients. CXCR7 overexpression in vitro is able to diminish DLBCL cell survival and increase their sensitivity to antitumor drugs. PMID: 29920526 Residues 2-6 of ACKR3 form an antiparallel beta-sheet with the beta1 strand (residues 25-29) of CXCL12. PMID: 28098154 These findings suggest that the manipulation of miR-539-5p/CXCR7 levels may have important therapeutic implications in choroidal neovascularization-associated diseases PMID: 29146732 CXCR7 is an oncogene in PCa that can promote aggressive progression of PCa through enhancing proliferation and migration of the tumor cells. PMID: 30047547 Study shows that overexpression of CXCR7 in different cellular populations of endometriosis microenvironment may play a role in the pathogenesis and represent a novel target for treatment. PMID: 29587613 CXCR7 silencing inhibits the migration and invasion of human tumor endothelial cells derived from hepatocellular carcinoma by suppressing STAT3. PMID: 29901083 Hetero-oligomerization of a1B/D-adrenergic receptor with the chemokine (C-X-C motif) receptor 4:atypical chemokine receptor 3 heteromeric complex is required for a1B/Dadrenergic receptor function PMID: 28862946 This work demonstrates distinct roles for the SDF-1/CXCR4 or CXCR7 network in human induced pluripotent stem cell-derived ventricular cardiomyocyte specification, maturation and function. PMID: 28711757 A role for CXCR7 in bladder cancer [review] PMID: 29022185 CXCR7-small hairpin RNA inhibits tumour invasion and metastasis. PMID: 28429395 Chemokine receptor CXCR7 may involve in the clinical glioblastoma (GBM) progression, and CXCR7 could be a valuable prognostic marker in the treatment of GBM. PMID: 28759950 Therefore, CXCR7 may be associated with peritoneal metastasis in gastric cancer. PMID: 27941339 CXCL12-CXCR7 axis accelerates migration and invasion of pancreatic cancer cells through mTOR and Rho/ROCK pathways, and predicts poor prognosis of pancreatic cancer PMID: 27542220 The CXCR7/CXCL12 axis is involved in lymph node and liver metastasis of gastric cancer. PMID: 28533662 Among 479 individuals affected with clear cell renal cell carcinoma, only synonymous variants were found in COPS8 and one of the missense variants in ACKR3:c.892C>T, was observed in 4/479 individuals screened PMID: 28063109 Results show that CXCR7 is highly expressed in metastatic lymph node (MNL) of non-small cell lung neoplasm (NSCLC) and is associated with poor prognosis. PMID: 29032612 While the potencies of all proteins in ACKR3 Presto-Tango assays were comparable, the efficacy of CXCL12(3-68) to activate ACKR3 was significantly reduced PMID: 29125867 CXCR7 mediates CD14(+)CD16(+) monocyte transmigration across the blood brain barrier, and is a potential therapeutic target for neuro AIDS. PMID: 28754798 CXCR7 signaling could not be detected using impedance measurements. However, increasing levels of CXCR7 expression significantly reduced the CXCR4-mediated impedance readout, suggesting a regulatory role for CXCR7 on CXCR4-mediated signaling. PMID: 28945785 CXCR7 expression in gastric cancer tissues was significantly higher than that in adjacent non-cancer tissues and associated with tumor size, TNM stage and lymph node metastasis. CXCR7 was identified as a novel promoter in gastric cancer initiation and progression. PMID: 28281844 the data identified the pivotal role of the receptor CXCR7 in pulmonary inflammation with a predominant effect on the pulmonary epithelium and polymorphonuclear neutrophils PMID: 28188248 SDF-1/CXCR7 plays a positive role in the proliferation and invasion of endometrial carcinoma cells. PMID: 28239742 our study demonstrates that the upregulation of CXCR7 signaling contributes to increased vasculogenic capacity of EOCs from CAD patients, indicating that CXCR7 signaling may be a novel therapeutic vasculogenic target for CAD. PMID: 27612090 CXCR7 expression in the tumor cells and stromal cells from the metastatic foci was significantly more common in the group of male patients treated with cytotoxic drugs according to the FOLFOX6 regimen PMID: 28295006 hypoxia and CXCL12-CXCR7 axis appeared to be advantageous microenvironments to CD20(-) CD138(-) cells in lymphoplasmacytic lymphoma PMID: 26878134 suppressing CXCR4 is not enough to impede osteosarcoma invasion in bone marrow microenvironment since CXCR7 is activated to sustain invasion. Therefore, inhibiting both CXCR4 and CXCR7 could be a promising strategy in controlling osteosarcoma invasion. PMID: 28468584 This short review intends to provide a concise summary of current knowledge with regards to cell-specific functions of CXCL12 and its receptors CXCR4 and CXCR7 with potential implications for the initiation and progression of atherosclerosis. [review] PMID: 25586789 CXCR7 overexpression is associated with gastric cancer. PMID: 27716367 CXCL12 may be an effective diagnostic marker for papillary thyroid carcinoma, and CXCL12/CXCR4/CXCR7 axis may contribute to thyroid cancer development by regulating cancer cell migration and invasion via AKT and ERK signaling and MMP-2 activation. PMID: 27082011 Our study suggested that CXCR7 plays an important proangiogenic role in hepatocellular carcinoma (HCC). via activation of the AKT pathway. So CXCR7 may be a potential target for antiangiogenic therapy in HCC PMID: 27572688 CXCR7 is a direct downstream target of miR-100, and overexpression of miR-100 efficiently suppresses CXCR7 expression. PMID: 27035873 Overexpression of CXCR7 is associated with breast cancer. PMID: 27460092 High CXCR7 expression is associated with endometrial cancer. PMID: 26678890 the current study revealed that CXCL12 which combined its receptors CXCR4 and CXCR7 together could promote cell migration and cell invasion of OSCC. PMID: 26232325 Increased CXCR7 expression is associated with invasion in nasopharyngeal carcinoma. PMID: 26715277 Up-regulation of miR-218 expression in renal cell carcinoma under hypoxia can result in significant and targeted down-regulation of CXCR7 expression. PMID: 27133059 CXCR7 affects the growth of PTC cells. PMID: 26383519 CXCR7 may play a role in the progression, metastasis and angiogenesis of otorhinolaryngologic tumours. PMID: 26996902 CXCR4 was co-expressed with all investigated neural and embryonic stem cell markers in both primary and recurrent tissues, whereas CXCR7 was mostly found on stem cell marker-negative cells, but was co-expressed with KLF-4 on a distinct GBM cell subpopulation PMID: 26821357 Expression levels of CXCR4 and CXCR7 in breast cancer tissues were significantly higher than that in adjacent normal tissues and patients with high CXCR4 and CXCR7 expression had a shorter survival time compared with those with low expression. PMID: 26722521 Data shows the relative expression of CXCR4 and CXCR7 in platelets, their dynamic trafficking, how they differentially mediate the functional and survival response to some chemokines, and their prognostic value in coronary artery disease. [review] PMID: 26551719 CXCR7 expression in colorectal carcinoma was correlated with tumor development and poor prognosis of patients. PMID: 26722500 TGFbeta1-CXCR7 axis may be a prognostic marker and may provide novel targets for combinational therapies to be used in the treatment of advanced lung cancer in the future PMID: 26212008 Evidences suggest an indispensable role of GLI1 in the migration and metastasis of breast cancer cells through CXCL12/CXCR4 signaling enhancement. PMID: 26413813 Developmental expression patterns of chemokines CXCL11, CXCL12 and their receptor CXCR7 in testes PMID: 25810367 STAT3 signaling downstream of CXCR7 is involved in miR-101 regulation of breast cancer cell behaviors. PMID: 26360780 CXCR7 is expressed on NogoA- and Nkx2.2-positive oligodendroglial cells in human multiple sclerosis brains. PMID: 26741980 This study found that elevated mRNA levels for CXCR7 (+29%; p<.0001) and CXCR4 (+14%, p=.052) in schizophrenia subjects. PMID: 25464914 the roles of CXCR4, CXCR7, and CXCL12 are associated with trophoblastic cells apoptosis and may be linked to the occurrence and development of severe preeclampsia PMID: 26721717

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.