Recombinant Human Arylsulfatase B (ARSB) Protein (His-SUMO)

Name: Recombinant Human Arylsulfatase B (ARSB) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-08594P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Arylsulfatase B (ARSB) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P15848
Target Symbol	ARSB
Synonyms	Arsb; ARSB_HUMAN; Arylsulfatase B; ArylsulfataseB; ASB; G4S; MPS6; N acetylgalactosamine 4 sulfatase; N-acetylgalactosamine-4-sulfatase
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Expression Range	37-533aa
Protein Length	Full Length of Mature Protein
Mol. Weight	72.0kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Removes sulfate groups from chondroitin-4-sulfate (C4S) and regulates its degradation. Involved in the regulation of cell adhesion, cell migration and invasion in colonic epithelium. In the central nervous system, is a regulator of neurite outgrowth and neuronal plasticity, acting through the control of sulfate glycosaminoglycans and neurocan levels.
Subcellular Location	Lysosome. Cell surface.
Protein Families	Sulfatase family
Database References	HGNC: 714 OMIM: 253200 KEGG: hsa:411 STRING: 9606.ENSP00000264914 UniGene: PMID: 29081414 Of the 20 patients included in the study, molecular genetic analysis was performed on 17 patients... molecular analysis results of four patients who was excluded from the overall study (three of which were another adult male siblings who did not receive ERT and one patient whose ERT duration was shorter than 6 months) were were included in determination of allele frequency of ARSB. PMID: 28884960 Three novel mutations in ARSB were detected, expanding the mutational spectrum of ARSB causing MPS VI. A compound heterozygous for the c.464G>A (p.C155Y) and c.1163G>C (p.R388T) mutations, a 13.8-kb deletion encompassing exons 2 and 3, mutation c.479G>A (p.R160Q), and novel c.464G>A (p.C155Y) mutation. PMID: 27797586 Mutation analysis of 19 Indian mucopolysaccharidosis VI patients revealed the presence of a total of 15 different mutations of which twelve were novel. PMID: 27826022 Nine novel mutations of ARSB were identified in MPS VI cases from India in the present study. The study also provides some insights into the genotype-phenotype association in MPS VI PMID: 26609033 Silencing Wnt9A increased the expression of CHST11 in the colonic epithelial cells, and chromatin immunoprecipitation assay demonstrated enhancing effects of Wnt9A siRNA and exogenous BMP4 on the CHST11 promoter PMID: 25511584 Arylsulfatase B regulates versican expression by galectin-3 and AP-1 mediated transcriptional effects. PMID: 24240681 Mutation analysis of the ARSB gene revealed seven missense and three frameshift mutations of which eight were novel. PMID: 24677745 These studies reveal how carrageenan exposure can lead to transcriptional events in colonic epithelial cells through decline in arylsulfatase B activity, with subsequent impact on C4S, galectin-3, Sp1, and Wnt9A PMID: 24778176 novel homozygous missense mutation, c.278 C>T, p.P93L, associated with mucopolysaccharidosis type VI PMID: 23855929 ARSB activity was significantly higher in the normal tissues. PMID: 23835622 PTC124 but not gentamicin, increases the level of ARSB activity. PMID: 22971959 results indicate that mammalian ARSB improves functional recovery after CNS injury. PMID: 23520469 Arylsulfatase B activity was significantly less in the polymorphonuclear leukocytes and mononuclear cells from the cystic fibrosis patients than controls. PMID: 22550062 Sequencing analysis revealed a novel homozygous missense mutation in the ARSB gene at c.1457A PMID: 23023219 investigation of substrate specificity of arylsulfatase B in colonic epithelial cells; competitive binding of complex polysaccharides/glycosaminoglycans with arylsulfatase B can affect generation of reactive oxygen species and inflammatory response PMID: 22079206 Hypoxia reduces arylsulfatase B activity and silencing arylsulfatase B replicates and mediates the effects of hypoxia. PMID: 22428001 13 mucopolysaccharidosis type VI patients were found to be homozygous for the previously undescribed H178L ARSB mutation PMID: 21996138 Altered ARSB immunostaining and reduced activity may be useful indicators of malignant transformation in human colonic tissue. PMID: 21378286 Mucopolysaccharidosis type VI: Structural and clinical implications of mutations in N-acetylgalactosamine-4-sulfatase PMID: 11668612 Seven novel mutation were identified in ARSB in mucopolysaccharidosis type VI patients undergoing a Clinical trial of enzyme replacement therapy, 3 of these mutations resulted in truncated proteins. PMID: 14974081 analysis of novel mutations on the arylsulphatase B gene in South American Mucopolysaccharidosis type VI patients PMID: 16435196 Decreased arylsulfatase B activity is associated with cystic fibrosis PMID: 17324393 The identification of many novel mutations unique to individuals/their families highlighted the genetic heterogeneity of the mucopolysaccharidosis VI disorder. PMID: 17458871 Novel mutations in arylsulfatase B is associated with mucopolysaccharidosis VI PMID: 17643332 modification of expression of the lysosomal sulfatases ASB and GALNS regulates the content of CSs. PMID: 18285341 Reduced activity of arylsulfatase B enzymatic activity in children with cystic fibrosis PMID: 18299243 All the ARSB mutations studied had a significant effect on enzyme activity, protein processing and/or mRNA stability. PMID: 18406185 arylsulfatase B gene mutation profile in Taiwanese MPS VI patients may be different from MPS VI patients from other countries[mucopolysaccharidosis type VI ] PMID: 18486607 IL-8 increases in bronchial epithelial cells after arylsulfatase B silencing due to sequestration with chondroitin-4-sulfate PMID: 19346317

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.