Recombinant Human Artemin (ARTN) Protein (His-GST&Myc)

Name: Recombinant Human Artemin (ARTN) Protein (His-GST&Myc)
Brand: Beta LifeScience
SKU: BLC-06981P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Artemin (ARTN) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q5T4W7
Target Symbol	ARTN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-GST&C-Myc
Target Protein Sequence	AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
Expression Range	108-220aa
Protein Length	Full Length of Mature Protein
Mol. Weight	47.1 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue.
Subcellular Location	Secreted.
Protein Families	TGF-beta family, GDNF subfamily
Database References	HGNC: 727 OMIM: 603886 KEGG: hsa:9048 STRING: 9606.ENSP00000387435 UniGene: Hs.632404
Tissue Specificity	Ubiquitous. Expressed at high levels in peripheral tissues including prostate, placenta, pancreas, heart, kidney, pituitary gland, lung and testis. Expressed at low levels in the brain.

Gene Functions References

Artemin could promote the proliferation and invasiveness of lung cancer cells in vitro and therefore could be a new potential target to combat lung cancer. PMID: 29575549
The data suggest that ARTN and MMP-9 are involved in the occurrence, development, invasion and metastasis of EC, and play a synergistic role in the development of EC and lymphatic metastasis. PMID: 29254290
AhR activation and ARTN expression were positively correlated in the epidermis of patients with atopic dermatitis. PMID: 27869817
Report the activity, pharmacokinetics, conformational dynamics and biophysical properties of different glycoforms of ART. PMID: 26908049
High ARTN increased xenograft tumor size and metastasis in hepatocellular carcinoma. PMID: 26675549
Artemin expression promotes invasiveness and neurotrophic function of pancreatic adenocarcinoma cells in vivo and in vitro PMID: 25243385
mRNA expression of Artemin (Artn) in the tongue mucosa of patients with burning mouth syndrome was significantly higher than that of control subjects. PMID: 26270588
This is the first report of increased levels of a neurotrophic factor and of a glial cell line-derived neurotrophic factor family member in GAD patients. PMID: 24994477
conclude that ARTN is one mediator of acquired resistance to trastuzumab in HER2-positive mammary carcinoma cells PMID: 24737320
The expression of GFRalpha1 and/or GFRalpha3, especially when combined with ARTN expression, may be useful predictors of disease progression and outcome in specific subtypes of mammary carcinoma. PMID: 23351331
ARTEMIN promotes de novo angiogenesis in ER negative mammary carcinoma through activation of TWIST1-VEGF-A signaling. PMID: 23185544
ARTN promotion of the cancer stem cell-like cell phenotype was mediated by TWIST1 regulation of BCL-2 expression. PMID: 23095743
High artemin promotes motility and invasiveness of pancreatic cancer. PMID: 22901124
artemin lowers the threshold of temperature-dependent itch sensation. PMID: 22770266
ARTN and TWIST1 synergize to produce a worse outcome in ER-MC and combined inhibition of ARTN and phosphatidylinositol 3-kinase/protein kinase B (PI3K/AKT) may therefore provide a novel therapeutic strategy in this subtype of mammary carcinoma. PMID: 22060274
Presenting an efficient method for the recombinant bacterial production of large quantities of highly pure, biologically active ARTN for in vitro and in vivo studies. PMID: 21907286
Studies indicate that artemin was highly expressed in squamous cell carcinoma lung cancer. PMID: 22008109
These results reveal that ARTN, a known tumor metastasis-related gene, is a direct target of miR-223. PMID: 21453483
Forced expression of ARTN in ER-positive human mammary carcinoma cells increased ER transcriptional activity, promoted estrogen-independent growth and produced resistance to tamoxifen. PMID: 20305694
ARTN increased BCL2 expression by transcriptional upregulation, and inhibition of BCL2 abrogated the oncogenic properties of ARTN in non-small cell lung carcinoma cells. PMID: 20530713
Artemin is a key player in the generation of pancreatic neuropathy in pancreatic neoplasms. PMID: 20395845
Artemin and GFRalpha3 expressions may play an important role in perineural invasion of pancreatic carcinoma. PMID: 19304517
expression in endometrial carcinoma significantly associated with higher tumor grade and invasiveness PMID: 20118197
The results obtained suggest the involvement of NTN, PSP, and ART in processes subserving both the organization of this cortical region during development and the functional activity and maintenance of the mature human hippocampal neurons. PMID: 15829225
This study suggests that ART binds heparan sulfate proteoglycans (HSPG) and identifies residues that may be involved in HSPG binding. PMID: 16734417
1.92 A crystal structure of the complex formed between ARTN and its receptor GFRalpha3 was reported. PMID: 16765900
Data show that reduced expression levels of ARTN mRNAs are found in patients with major depressive disorder in a current depressive state, but not in a remissive state. PMID: 18313696
No differences were found in the allelic frequencies of the variants or in the haplotype distribution between Hirschsprung's disease patients & controls, nor to any demographic/clinical parameters within the group of patients. PMID: 18970938
Forced expression of artemin in mammary carcinoma cells results in increased anchorage-independent growth, increased colony formation in soft agar and in Matrigel, and promotes a scattered cell phenotype with enhanced migration and invasion. PMID: 19363524

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.