Recombinant Human Apolipoprotein A-V (APOA5) Protein (His-GST&Myc)

Name: Recombinant Human Apolipoprotein A-V (APOA5) Protein (His-GST&Myc)
Brand: Beta LifeScience
SKU: BLC-06404P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Apolipoprotein A-V (APOA5) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q6Q788
Target Symbol	APOA5
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-GST&C-Myc
Target Protein Sequence	AFAGTGTEEGAGPDPQMLSEEVRQRLQAFRQDTYLQIAAFTRAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWEDITHSLHDQGHSHLGDP
Expression Range	260-366AA
Protein Length	Partial
Mol. Weight	47.0 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Minor apolipoprotein mainly associated with HDL and to a lesser extent with VLDL. May also be associated with chylomicrons. Important determinant of plasma triglyceride (TG) levels by both being a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and an inhibitor of the hepatic VLDL-TG production rate (without affecting the VLDL-apoB production rate). Activates poorly lecithin:cholesterol acyltransferase (LCAT) and does not enhance efflux of cholesterol from macrophages. Binds heparin.
Subcellular Location	Secreted. Early endosome. Late endosome. Golgi apparatus, trans-Golgi network.
Protein Families	Apolipoprotein A1/A4/E family
Database References	HGNC: 17288 OMIM: 144650 KEGG: hsa:116519 STRING: 9606.ENSP00000227665 UniGene: PMID: 29735301 Evidence has established the association between the presence of APOA5 gene SNPs and the risk for obesity. (Review) PMID: 30053818 Polymorphisms of the genes MTHFR (rs1801133) and APOA5 (rs662799), as well as anemia, are independent risk factors for stroke in Mexicans, together with traditional cardiovascular risk factors such as high triglycerides and high blood pressure. PMID: 29398535 Different linkage disequilibrium was found betweenAPOA5 rs207560 and rs3135506 variants in Roma compared to Hungarians PMID: 28102463 APOA5 polymorphisms rs662799 and rs3135507, with the CC and the AA genotypes, respectively, are associated with increased levels of both high-density lipoprotein cholesterol (HDL-C) and low-density lipoprotein cholesterol (LDL-C) in the Turkish Cypriot population. PMID: 29264753 rs670, rs2854116, and rs662799 single nucleotide polymorphisms of the APOA1-C3-A5 cluster are associated with ischemic stroke in the northern Chinese Han population. PMID: 28635360 The minor allele rs662799 in APOA5 was risk factor for coronary artery disease occurrence in the Chinese Han population. PMID: 29310573 Heterozygous carriers of the variants of APOA5 display more pronounced post-prandial lipemia after pure fat load than wild-type carriers. PMID: 28730827 Review/Meta-analysis: significant association of APOA5 rs662799 CC and APOA5 rs3135506 CG with increased risk of ischemic stroke. PMID: 28865324 The data clearly show that the Arg282Ser mutation in APOA5 gene determines a reduction of triglycerides, total and LDL-cholesterol and apolipoprotein A-V levels in overweight/obese children and adolescents, demonstrating that this mutation has the power to affect lipid levels already since childhood. PMID: 28927406 First study reporting the association of APOA5 gene variants with Metabolic Syndrome in Tunisia. This study emphasizes the role of APOA5 variants in the regulation of the triglycerides blood levels. PMID: 28624160 that apos involved in TG metabolism such as apoC2, C3, E, and A4 (micromolar concentration), and apoB48 and apoA5 (single-digit nanomolar concentration) can be quantified from a single digestion mixture. PMID: 24694356 APOA5 variants cause Hypertriglyceridemia. In high Cardiovascular risk patients APOA5 variants elevate triglyceride levels and shift the entire lipoprotein subclass distribution toward Atherogenic Dyslipidemia. PMID: 28500476 Triglyceride-raising variant alleles of the APOA5 encoding apo A-V, associated with clinical Cardiovascular endpoints. PMID: 28534127 Hypertriglyceridemic patients carrying the APOA5 -1131T>C polymorphism exhibited increased atherogenic LDL levels and arterial stiffness, probably due to an effect of the -1131T>C polymorphism on apoA5 concentrations PMID: 29211729 The minor alleles of rs662799 (APOA5) and rs5072 (APOA1) modulate TG levels in Mexican children PMID: 27171122 Rare variants in LPL and a common variant in APOA5 were more commonly found in Thai subjects with severe hypertriglyceridemia PMID: 27206937 Collectively, these data demonstrate that APOA5 SNP rs651821 might be an important host genetic factor in determining the abundances of the health-promoting Bifidobacterium bacteria and the taxa to which this genus belongs. PMID: 27053630 Data suggest that estrogen up-regulates serum concentrations of APOA5 and subsequently decreases serum triglyceride levels; APOA5 levels are higher in woman than in men, and the negative relationship between APOA5 and serum triglyceride levels is more significant in woman. PMID: 28376804 Methylation in exon 3 of APOA5 and epigenetic variability are associated with high circulating triacylglycerol levels. PMID: 27613158 the lead variant was the rs1558861 [1.99 (1.73-2.30); p = 7.37 x 10(-22) ], residing on chromosome (chr) 11 at the apolipoprotein A-I/A-5 (APOA1/APOA5) locus PMID: 27599772 The single nucleotide polymorphisms in lipoprotein lipase, ApoA5, and CETP were associated with serum triglycerides and HDL-cholesterol levels, but not with coronary artery disease in Pakistani population under study. PMID: 28143480 ur data indicate that the APOA5 rs662799 polymorphism is associated with dyslipidemia and the severity of coronary heart disease in Chinese women. PMID: 27716220 HBV inhibits ApoA5 expression at both the transcriptional and translational levels through its core gene PMID: 27724895 Compared with APOA5 c.553 GG carriers, c.553T carriers displayed an increased risk of HTG in the Asian population, with an overall random effects OR of 3.55 (95% CI: 2.46-5.13) in the dominant model.Our results suggest that APOA5 c. 553T is an independent risk factor for HTG and increased triglyceride levels in the Asian population. PMID: 27813673 Genetic polymorphisms of T-1131C APOA5 and ALOX5AP SG13S114 can be considered risk factors for the susceptibility to ischemic stroke in Morocco. PMID: 27350673 Data show that polymorphisms of rs662799 and rs2266788 in APOA5 gene, rs320 in LPL gene and rs708272 in CETP gene had significant association with the effect of the lipid-lowering therapy via atorvastatin on ischemic stroke patients. PMID: 27415775 In this study, we investigated the association between the ApoA5 -1131T>C and -12,238T>C polymorphic loci in Korean patients with metabolic syndrome PMID: 26760709 Serum triglycerides and very low-density protein levels were significantly high in children and adolescents carrying the 19WW apoa5 genotype. PMID: 27051036 meta-analysis provides substantial evidence that the APOA5 -1131T/C polymorphism might contribute to coronary artery disease development in the Chinese population PMID: 26505382 The results of our meta-analysis point to a strong link between both APOA5 -1131T>C and APOC3 -455T>C polymorphisms and an increased risk ofcoronary heart disease . PMID: 26782469 A potential role for APOA5 common variants and related haplotypes as risk factors for obesity. PMID: 26524954 APOA5 rs2075291 could play an important role in triglyceride and HDL-C level in metabolic syndrome, while the association of APOA5 rs662799 polymorphism is still under debate. PMID: 26702748 the TT genotype of APOA5 c.553G T may have an important role in Taiwanese patients with hypertriglyceridemia PMID: 25843152 APOA5 rs662799 polymorphism has interactions with the environmental factors associated with metabolic syndrome X. PMID: 26824674 APOA5 -1131 T > C and APOC3 -455 T > C SNPs may play potent roles in the development and progression of coronary heart disease. (Meta-analysis) PMID: 26387083 Single nucleotide polymorphisms (Rs651821) of APOA5 protein did not increase the risk of CHD in the Chinese population. PMID: 26397108 Both the case-control study and meta-analysis confirm a significant association between APOA5 rs662799 and coronary heart disease. The results suggest a male-specific association between the APOA5 rs662799 polymorphism and coronary heart disease. [meta-analysis] PMID: 26309253 ApoA-V in neonates was unique in its serum concentration and in the association with lipoprotein profile PMID: 26350810 The polymorphisms rs662799 near APOA5 and rs769450 in APOE had significant association with metabolic syndrome X and its components in Korean males. PMID: 26365620 Dietary fat intake modifies the effect of APOA5 and LEPR polymorphisms on serum triglycerides, cholesterol levels and obesity in young subjects. PMID: 26365669 No SNPs within the BUD13-APOA5 region were associated with effect on HDL-cholesterol reduction but did have an effect on triglyceride and LDL-cholesterol levels following statin therapy. PMID: 25900265 Our data support the hypothesis that apoA5 promotes hepatic TG storage and therefore contributes to the pathogenesis of non-alcoholic fatty liver disease PMID: 25938357 cross-sectional study revealed the essential roles of the polymorphisms and haplotypes of APOA5 in the dysregulations of triglyceride levels in Uyghur population, which is an admixture population of Caucasians and East Asians PMID: 25313938 In a dyslipemic population, genetic variants of APOA5 modulate lipoprotein subclass distributions, inducing an atherogenic profile associated with IMT defined subclinical atherosclerosis. PMID: 25770687 Suggest ApoA5 genetic polymorphisms are associated with susceptibility to steroid-induced osteonecrosis of femoral head in Chinese population. PMID: 25515090 Results show that the USF1 and APOA5 polymorphisms are associated with Familial combined hyperlipidemia and that the S19W SNP in the APOA5 gene is associated to the disease independently of total cholesterol, triglycerides and body mass index. PMID: 25308402 APOA5 variants were associated with dyslipidemia and obesity in Mexicans. PMID: 24886709 remarkable association especially between the -1131C Apo A5 variant and increased tPA levels in asymptomatic dyslipidemic patients PMID: 24815086 analysis of methylation patterns of the APOA1/C3/A4/A5 cluster that may be directly involved in the transcriptional regulation of this cluster, especially in liver PMID: 25463085

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.