Recombinant Human Antileukoproteinase (SLPI) Protein (His&Myc)

Name: Recombinant Human Antileukoproteinase (SLPI) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-11135P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Antileukoproteinase (SLPI) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P03973
Target Symbol	SLPI
Synonyms	ALK 1; ALK1; ALP; Antileukoprotease; Antileukoproteinase 1; Antileukoproteinase; Antileukoproteinase1; BLPI; Human seminal protease inhibitor; HUSI 1; HUSI; HUSI I; HUSI-1; MPI; Mucus proteinase inhibitor; Protease inhibitor WAP4; Secretory leukocyte peptidase inhibitor; Secretory leukocyte protease inhibitor; Seminal proteinase inhibitor; SLPI; SLPI_HUMAN; WAP four disulfide core domain protein 4; WAP four-disulfide core domain protein 4; WAP4; WFDC4
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Expression Range	26-132aa
Protein Length	Full Length of Mature Protein
Mol. Weight	16.7 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. Modulates the inflammatory and immune responses after bacterial infection, and after infection by the intracellular parasite L.major. Down-regulates responses to bacterial lipopolysaccharide (LPS). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses. Has antimicrobial activity against mycobacteria, but not against salmonella. Contributes to normal resistance against infection by M.tuberculosis. Required for normal resistance to infection by L.major. Required for normal wound healing, probably by preventing tissue damage by limiting protease activity. Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells.
Subcellular Location	Secreted.
Database References	HGNC: 11092 OMIM: 107285 KEGG: hsa:6590 STRING: 9606.ENSP00000342082 UniGene: PMID: 30180755 we investigated the biological effects of SLPI using Cell Counting Kit (CCK)-8, Annexin V/PI apoptosis assay and Caspase-Glo(R) 3/7 assay. The findings revealed that SLPI promoted apoptosis in the Leuk1 and WSU-HN4 cell lines. Mechanistic studies indicated that SLPI, at least in part, regulated cell apoptosis by inhibiting the expression of TNF receptor-associated factor 1 PMID: 29436667 Together, these data support the clinical evaluation of dual angiogenic inhibition of the ALK1 and VEGF pathways in patients with advanced renal cell carcinoma (RCC) . PMID: 28031424 the patients with systemic sclerosis had significantly increased serum levels of SLPI in comparison with the rheumatoid arthritis patients and the healthy controls PMID: 28606626 gene expression profiling study based on microarray data for the three cell types identified a number of candidates, including LCP1 and GLI, that could be key molecules in the mechanism of SLPI-induced cell migration PMID: 28637988 we show that SLPI acts as a key mediator in regulating the function of hepatic myeloid cells, to promote resolution responses through induction of MerTK expression within the resident macrophage population. PMID: 28450389 these data demonstrate increased anti-inflammatory activity of the SLPI-A16G protein compared with SLPI-WT in a murine model of pulmonary Pseudomonas infection PMID: 26376365 we demonstrated that the oncogenic effect of SLPI may be due to protection of growth factor progranulin from enzymatic cleavage or suppression of castration-resistant prostate cancer (CRPC)cell apoptosis independent of anti-protease activity of SLPI. These findings implicate SLPI as a potential biomarker of resistance to AR inhibition and therapeutic target for CRPC treatment PMID: 26876202 Secretory leukocyte protease inhibitor mediates invasiveness of oral carcinoma cells. PMID: 27238568 The results indicate that SERPINE2 and SLPI play a significant role in the development of papillary thyroid cancer and imply that the evaluation of serum concentrations of both anticoagulant molecules may be considered as additional marker for the differentiation of malignancies during the preoperative diagnosis of patients with thyroid gland tumors. PMID: 28255192 Bronchial epithelial cells have decreased SLPI expression in response to hypoxia. PMID: 25851169 Ongoing herpes simplex virus infection and resultant downregulation of local levels of SLPI may impart a greater susceptibility for keratinocytes to human papillomavirus type 16 infection through the host cell receptor annexin A2. PMID: 26555393 SLPI is an independent predictor for both OS and DSS and a relevant prognostic biomarker in OSCC. PMID: 24764155 The elevations in cervical elafin and SLPI expression in the women with preterm delivery might reflect the local response to the pathogen invasion into the cervix preceding preterm labor. PMID: 25559229 These results demonstrate that SLPI down-regulates pIgR expression through the NF-kappaB signaling pathway by inhibiting degradation of IkappaBbeta protein. PMID: 26239418 Abnormal over-expression of SLPI in pancreatic cancer cells may be associated with the development of disease through its roles in promoting cancer cell survival and proliferation as well as anti-apoptosis. PMID: 25319722 study identifies a distinct immune response in SA characterized by a dysregulated IFN-gamma/SLPI axis that affects lung function. PMID: 26121748 findings support a controlling role for SLPI in NET generation, which is of potential relevance to infectious and autoinflammatory diseases PMID: 25917460 We identify SLPI as a new player in acquisition of microbial hyporesponsiveness by buccal and intestinal epithelium in the first weeks after microbial colonisation. PMID: 25056659 Studies suggest that secretory leukocyte protease inhibitor (SLPI) as a mediator of systemic immune paresis in acute liver failure (ALF). PMID: 25041028 Report presence of SLPI in vaginal secretions and its regulation in response to vaginal microbiota and to the concentrations of antimicrobial and proinflammatory mediators. PMID: 24023032 Both mRNA and protein levels of SLPI were significantly higher in patients with biofilm associated chronic rhinosinusitis (CRS) than those with CRS and no biofilm and controls. PMID: 24121782 These results show that Mycobacterium tuberculosis-induced IFN-gamma down-modulated SLPI levels by signaling through the IFN-gammaR in healthy donors. PMID: 24606882 SLPI has antiprotease activity and antimicrobial activity against bacteria and fungi. SLPI is an important molecule in the functioning of the innate immune system. PMID: 16336202 findings demonstrate that SLPI plays an important role from the initial stages of lung carcinogenesis to the progression of lung cancer in an NF-kappaB-dependent manner PMID: 24282288 These results indicate that SLPI controls the proliferation, differentiation, and cell cycle of myeloid cells. PMID: 24352879 The aim of this study was to investigate the intracellular function of SLPI and the mechanism-based modulation of neutrophil function by this antiprotease. PMID: 24073410 Low SLPI expression is associated with papillomavirus infected head and neck squamous cell carcinomas. PMID: 23996702 SLPI is bactericidal for gonococci and is expressed by reproductive tract epithelial cells and thus is likely to play a role in the pathogenesis of gonococcal infection. PMID: 22537232 SLPI may contribute to psoriasis by enabling pDCs to sense extracellular DNA and produce IFN type I. PMID: 22786767 Circulating SLPI increases with progressive metabolic dysfunction and is related to metabolic and inflammatory parameters in men PMID: 21377455 confirmed that SLPI is significantly down-regulated in NPC tissues. In addition, based on our preliminary results, we propose that the reduction of SLPI in NPC cells is associated with the presence of the EBV genome and/or expression of EBV-encoded genes PMID: 22493362 decreased expression in female reproductive tract in postmenopausal women with hormonal treatment PMID: 21940052 Results show that SLPI promotes the metastasis of SNU638 gastric cancer cells by increasing MMP-2 and MMP-9 expression through Elk-1 signaling, indicating its role as a signaling molecule not a protease inhibitor. PMID: 21687932 SLPI may possess antitumorigenic activity by virtue of its ability to interfere with multiple requisite proteolytic steps underlying tumor cell invasion. PMID: 21641406 SLPI stimulates ovarian cancer invasion, modulated in part by its serine protease inhibitory activity attenuating MMP-9 release. PMID: 21676452 The results presented here clearly indicate the repression of SLPI, measurable on both, mRNA and protein levels in metastatic primary HNSCC as compared to non-metastatic HNSCC. PMID: 21503571 Constitutive expression of SLPI directly reduces the inflammatory response in the respiratory tract and improves lung function in an acute model of allergic asthma in SLPI transgenic and knockout mice. PMID: 21335488 these findings indicate upregulation of SLPI in response to LPS in nasal secretions and show anti-apoptotic effects of SLPI in primary human neutrophils suggesting a new role of SLPI during neutrophilic inflammation. PMID: 21077989 SLPI inhibited the expression of MMP-9 and IL-8 in normal human bronchial epithelial cells induced by cigarette smoke extract. PMID: 18953959 17Beta-estradiol inhibits IL-8 in cystic fibrosis by up-regulating secretory leucoprotease inhibitor PMID: 20378727 Our observations are the first to implicate SPARC, SLPI, and NLRP2, a component of the innate immune system, in the pathogenesis of axial spondyloarthropathy PMID: 19900269 Secretory leukocyte protease inhibitor antagonizes paclitaxel in ovarian cancer cells, and contribute to drug resistance. PMID: 20068074 Using transgenic mice over-expressing secretory leukocyte protease inhibitor, this study shows an early protective effect after spinal cord contusion injury. PMID: 20047904 Synthesized locally at mucosal sites. Efficiently inhibit target enzymes released into interstitium. Might be important in controlling excessive neutrophil elastase release in chronic obstructive pulmonary disease and cystic fibrosis. (review) PMID: 11667971 Secretory leukocyte protease inhibitor in punch biopsies from human colonic mucosa. PMID: 11759111 possible role in the defence against ascending urinary tract infections; establishing a source of SLPI in renal tubuli cells. PMID: 11817677 Secretory leukocyte proteinase inhibitor and elafin are resistant to degradation by MMP-8. PMID: 11868825 results indicate that menstrual status (pre- vs. postmenopausal) influences the production of SLPI and bactericidal activity by uterine epithelial cells PMID: 12023766 mediates proliferation of human endometrial epithelial cells by positive and negative regulation of growth-associated genes PMID: 12023969

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.