Recombinant Human Antileukoproteinase (SLPI) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11135P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Antileukoproteinase (SLPI) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11135P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Antileukoproteinase (SLPI) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P03973 |
| Target Symbol | SLPI |
| Synonyms | ALK 1; ALK1; ALP; Antileukoprotease; Antileukoproteinase 1; Antileukoproteinase; Antileukoproteinase1; BLPI; Human seminal protease inhibitor; HUSI 1; HUSI; HUSI I; HUSI-1; MPI; Mucus proteinase inhibitor; Protease inhibitor WAP4; Secretory leukocyte peptidase inhibitor; Secretory leukocyte protease inhibitor; Seminal proteinase inhibitor; SLPI; SLPI_HUMAN; WAP four disulfide core domain protein 4; WAP four-disulfide core domain protein 4; WAP4; WFDC4 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA |
| Expression Range | 26-132aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 16.7 kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. Modulates the inflammatory and immune responses after bacterial infection, and after infection by the intracellular parasite L.major. Down-regulates responses to bacterial lipopolysaccharide (LPS). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses. Has antimicrobial activity against mycobacteria, but not against salmonella. Contributes to normal resistance against infection by M.tuberculosis. Required for normal resistance to infection by L.major. Required for normal wound healing, probably by preventing tissue damage by limiting protease activity. Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells. |
| Subcellular Location | Secreted. |
| Database References | HGNC: 11092 OMIM: 107285 KEGG: hsa:6590 STRING: 9606.ENSP00000342082 UniGene: PMID: 30180755 |
