Recombinant Human Antigen-Presenting Glycoprotein Cd1D (CD1D) Protein (His-SUMO)

Name: Recombinant Human Antigen-Presenting Glycoprotein Cd1D (CD1D) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09859P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Cluster of differentiation (cd) proteins, Featured cd protein molecules, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Antigen-Presenting Glycoprotein Cd1D (CD1D) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P15813
Target Symbol	CD1D
Synonyms	Antigen-presenting glycoprotein CD1d; CD1.1; CD1A; CD1d; CD1D antigen; CD1D antigen d polypeptide; CD1d molecule; CD1D_HUMAN; Cd1d1 ; differentiation antigen CD1 alpha 3 ; HMC class I antigen like glycoprotein CD1D ; Ly 38; MGC34622; R3; R3G1; T cell surface glycoprotein CD1d ; Thymocyte antigen CD1D
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS
Expression Range	20-301aa
Protein Length	Extracellular Domain
Mol. Weight	47.9kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Basolateral cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Database References	HGNC: 1637 OMIM: 188410 KEGG: hsa:912 STRING: 9606.ENSP00000357153 UniGene: PMID: 28633979 CD1D has a role in disease progression and survival of chronic lymphocytic leukemia and may interact with CD161 PMID: 27385215 CD1d-expressing cells isolated from peripheral blood of allogeneic hematopoietic stem cell transplantation patients showed the suppressive activity of T cell proliferation and higher expression of MyD88 and IDO compared with CD1d(-) cells. PMID: 29108995 These findings suggest that VP22 is required (but not sufficient) for the inhibition of CD1d-mediated antigen presentation in herpes simplex virus type 1 infection. PMID: 27327902 FasL expression in splenic CD5(+)CD1d(hi) B cells was decreased compared to the control group after TLR4 ligation. PMID: 28505514 The expression of CD1d showed a significantly negative correlation with CD86 level in B cells from imiquimod (IMQ)-treated mice, B6.MRLlpr mice, and lupus erythematosus (SLE) patients. PMID: 28338767 CD1d-restricted peripheral T cell lymphoma in mice and humans PMID: 27069116 BCR-ABL-dependent ROCK, but not TK, is involved in CD1d downregulation. We propose that ROCK, which is most likely activated by the DH/PH domain of BCR-ABL, mediates iNKT-cell immune subversion in chronic myeloid leukaemia (CML) patients by downregulating CD1d expression on CML mDCs. PMID: 27513300 Importantly, among the analyzed molecules, only CD1d expression showed an association with the activation of double-negative T cells, as well as with worse ventricular function in patients with Chagas disease. PMID: 27368347 Data suggest that CD1d antigen-restricted B lymphocytes (Bc) presentation of NGcGM3 drives effective invariant natural killer T cells (iNKT) activation. PMID: 26969612 the spatiotemporal distribution of CD1d molecules on the surface of antigen-presenting cells (APCs) modulates activation of Invariant natural killer T cells. PMID: 26798067 both membrane-bound (V4) and soluble (V5) isoforms of CD1d were over-expressed in gastric tumor tissues, suggesting that they are involved in anti-tumor immune responses. PMID: 26119195 This suggests that CD1D is more polymorphic than previously assumed PMID: 26041373 by controlling a fundamental step in CD1d-mediated lipid antigen presentation, STAT3 signalling promotes innate immune responses driven by CD1d PMID: 26260288 CD1d acts as a cell surface receptor that recognizes and binds oxysterols and initializes a pathway connecting oxysterol binding to PPARgamma activation PMID: 25618030 Using diffraction-based dotReadytrade mark immunoassays, the present study showed that staphylococcal enterotoxin B directly and specifically conjugated to CD1d. PMID: 25649790 High CD1d expression is associated with medulloblastomas. PMID: 25115738 our results demonstrate that both Ets1 and miR-155 can directly regulate the expression of CD1d on B-cells PMID: 25929465 Ablation of this phosphorylation abolished herpes simplex virus 1 US3-mediated downregulation of CD1d expression, suggesting that phosphorylation of KIF3A is the primary mechanism of viral suppression of CD1d expression. PMID: 25878107 simplexide, apart from activating iNKT cells, induces the production of cytokines and chemokines from human monocytes by direct interaction with CD1d PMID: 25390653 CD1d expression in renal cell carcinoma correlated with aggressive disease and poorer clinical outcomes. PMID: 25477528 These findings highlight how components from alphabeta and gammadeltaTCR gene loci can recombine to confer antigenic specificity. PMID: 25452463 Expression of CD1d on B cells is suggestive of the ability of these cells to present antigens to, and form cognate interactions with, invariant natural killer T-Cells. (Review) PMID: 25381357 We suggest that unique set of interactions between CEACAM5, CD1d, and CD8 render CD1d more class I-like molecule, facilitating antigen presentation and activation of CD8(+)-suppressor regulatory T cells. PMID: 24104458 Data indictate variable expression of CD1d on chronic lymphocytic leukemia (CLL)lymphocytes and an association between high expression of CD1d with shorter time to treatment and overall survival of patients. PMID: 23668820 results showed the interaction between endoplasmic reticulum (ER)- lumenal domain of HCMV US2 and alpha3 domain of hCD1d was observed within ER; these results show the function of HCMV US2 in immune evasive mechanisms against anti-viral immunity of invariant NKT cells PMID: 24213674 CXCL16, iNKT cell-associated cell marker Valpha24, and CD1d were significantly upregulated in esophageal biopsies from EoE patients and correlated with the expression of inflammatory mediators associated with allergy. PMID: 24513807 Relationship between high CD1d expression and shorter time to treatment and overall survival in chronic lymphocytic leukemia. CD1d expression in individual patients significantly changed over time. PMID: 24418751 MHC class I physically associates with CD1d and regulates its functional expression on the cell surface. PMID: 24009709 these results provide new insight into the control of CD1d gene expression, and they have implications for the evolution of CD1d and type I NKT cells. PMID: 24307737 CD1d was found selectively expressed on the surface of hepatocytes in chronic hepatitis C, but not those subjects with history of alcohol usage or resolved chronic hepatitis C. PMID: 23808994 The gamma-delta TCR docked orthogonally, over the A' pocket of CD1d, in which the Vdelta1-chain, and the germ line-encoded CDR1d loop, dominated interactions with CD1d. PMID: 24076636 our findings strongly suggest that T322 and S323 form a dual residue motif that can regulate the functional expression of CD1d during a viral infection. PMID: 23710894 Total CD1d levels are upregulated in pollen lipid-treated dendritic cells, which are then able to activate invariant natural killer (NK)T cells through a CD1d-dependent pathway. PMID: 23265858 Type II NKT cells are absolutely dependent on CD1d expression in the thymus for their selection. CD1d trafficks between the cell surface & endosomes. It plays a role in presentating lipid antigens & mycobacterial antigens. Review. PMID: 23468111 A novel, autoreactive, CD1d-restricted, GPI-specific T-cell population, enriched in an invariant TCRalpha chain, is expanded in paroxysmal noctural hemoglobinuria and may be responsible for bone marrow failure. PMID: 23372165 Antigen presentation of keratinocyte to invariant killer cells show that these cells do not activate the cytotoxicity effector genes in resting iNKT-cells, but had the capacity to serve as targets for activated iNKT-cells dependent on CD1d expression. PMID: 23171451 CD1d protein structure determines species-selective antigenicity of isoglobotrihexosylceramide (iGb3) to invariant NKT cells. PMID: 23280365 A correlation between CD1d expression (a negative prognostic marker) and the soluble CTLA-4 in B-ALL patients was observed. PMID: 23049754 crystallographic and biophysical analyses of alpha-galactosylceramide (alpha-GalCer) recognition by a human CD1d-restricted TCR PMID: 23109910 Recombinant Vdelta1 TCRs from different individuals were shown to bind recombinant CD1d-sulfatide complexes in a sulfatide-specific manner. PMID: 22829134 Human and mouse type I natural killer T cell antigen receptors exhibit different fine specificities for CD1d-antigen complex PMID: 22995911 The binding of Sp1 to CD1d promoter and histone H3 acetylation on Sp1 sites were increased by histone deacetylase inhibitors. PMID: 22419072 These findings provide insight into how lysophospholipids are presented by human CD1d molecules and how this complex is recognized by some, but not all, human Invariant Natural Killer T cells. PMID: 22395072 Enhancing immunostimulatory function of human embryonic stem cell-derived dendritic cells by CD1d overexpression. PMID: 22407918 Defective B cell-mediated stimulation of iNKT cells in SLE patients was associated with altered CD1d recycling. PMID: 22406267 The serine-containing variant showed the strongest CD1d binding, offering an explanation for its predominance in vivo. PMID: 21956730 CD1d appears to modulate some metabolic functions through an iNKT-independent mechanism PMID: 21980475 phenyl glycolipids showed greater binding avidity and stability for iNKT T-cell receptor when complexed with CD1d PMID: 21987790 These findings provide the basis for investigations into a role for CD1d in lung mucosal immunity. PMID: 21853044

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.