Recombinant Human Antigen-Presenting Glycoprotein Cd1D (CD1D) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09859P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Antigen-Presenting Glycoprotein Cd1D (CD1D) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09859P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Antigen-Presenting Glycoprotein Cd1D (CD1D) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P15813 |
| Target Symbol | CD1D |
| Synonyms | Antigen-presenting glycoprotein CD1d; CD1.1; CD1A; CD1d; CD1D antigen; CD1D antigen d polypeptide; CD1d molecule; CD1D_HUMAN; Cd1d1 ; differentiation antigen CD1 alpha 3 ; HMC class I antigen like glycoprotein CD1D ; Ly 38; MGC34622; R3; R3G1; T cell surface glycoprotein CD1d ; Thymocyte antigen CD1D |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS |
| Expression Range | 20-301aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 47.9kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. Basolateral cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. |
| Database References | HGNC: 1637 OMIM: 188410 KEGG: hsa:912 STRING: 9606.ENSP00000357153 UniGene: PMID: 28633979 |
