Recombinant Human Angiotensinogen (AGT) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08176P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Angiotensinogen (AGT) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08176P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Angiotensinogen (AGT) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P01019 |
| Target Symbol | AGT |
| Synonyms | Aangiotensinogen (serpin peptidase inhibitor clade A member 8); AGT; AI265500; Alpha 1 antiproteinase antitrypsin; Ang; Ang I; Ang II; Ang III; AngII; Angiotensin I; Angiotensin II; Angiotensin III; Angiotensin-3; Angiotensinogen (PAT); Angiotensinogen; ANGT_HUMAN; ANHU; ANRT; AT-2; AT-II; Des-Asp[1]-angiotensin II; FLJ92595; FLJ97926; MGC105326; PAT; Pre angiotensinogen; Serine (or cysteine) proteinase inhibitor; Serpin A8; Serpin peptidase inhibitor clade A member 8; SERPINA8 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | VIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNS |
| Expression Range | 44-427aa |
| Protein Length | Partial |
| Mol. Weight | 57.9kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis.; acts directly on vascular smooth muscle as a potent vasoconstrictor, affects cardiac contractility and heart rate through its action on the sympathetic nervous system, and alters renal sodium and water absorption through its ability to stimulate the zona glomerulosa cells of the adrenal cortex to synthesize and secrete aldosterone.; stimulates aldosterone release.; is a ligand for the G-protein coupled receptor MAS1. Has vasodilator and antidiuretic effects. Has an antithrombotic effect that involves MAS1-mediated release of nitric oxide from platelets. |
| Subcellular Location | Secreted. |
| Protein Families | Serpin family |
| Database References | HGNC: 333 OMIM: 106150 KEGG: hsa:183 STRING: 9606.ENSP00000355627 UniGene: PMID: 29578435 |
