Recombinant Human Angiotensinogen (AGT) Protein (His-SUMO)

Name: Recombinant Human Angiotensinogen (AGT) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-08176P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Angiotensinogen (AGT) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P01019
Target Symbol	AGT
Synonyms	Aangiotensinogen (serpin peptidase inhibitor clade A member 8); AGT; AI265500; Alpha 1 antiproteinase antitrypsin; Ang; Ang I; Ang II; Ang III; AngII; Angiotensin I; Angiotensin II; Angiotensin III; Angiotensin-3; Angiotensinogen (PAT); Angiotensinogen; ANGT_HUMAN; ANHU; ANRT; AT-2; AT-II; Des-Asp[1]-angiotensin II; FLJ92595; FLJ97926; MGC105326; PAT; Pre angiotensinogen; Serine (or cysteine) proteinase inhibitor; Serpin A8; Serpin peptidase inhibitor clade A member 8; SERPINA8
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	VIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNS
Expression Range	44-427aa
Protein Length	Partial
Mol. Weight	57.9kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis.; acts directly on vascular smooth muscle as a potent vasoconstrictor, affects cardiac contractility and heart rate through its action on the sympathetic nervous system, and alters renal sodium and water absorption through its ability to stimulate the zona glomerulosa cells of the adrenal cortex to synthesize and secrete aldosterone.; stimulates aldosterone release.; is a ligand for the G-protein coupled receptor MAS1. Has vasodilator and antidiuretic effects. Has an antithrombotic effect that involves MAS1-mediated release of nitric oxide from platelets.
Subcellular Location	Secreted.
Protein Families	Serpin family
Database References	HGNC: 333 OMIM: 106150 KEGG: hsa:183 STRING: 9606.ENSP00000355627 UniGene: PMID: 29578435 Unfavorable genotype of polymorphic variants of candidate gene participating in endothelial dysfunction AGT (Thrl74Met and Met23SThr) was associated with changes in levels of their active substances in individuals exposed to mercury. PMID: 30351652 Angiotensin 1-7 can modulate cell adhesion and epithelial-mesenchymal transition of normal prostate epithelial cells. PMID: 29802847 These findings reveal the critical role of hypoxia in producing local angiotensin II by a lactate-chymase-dependent mechanism and highlight the importance of local angiotensin II in regulating radioresistance of hypoxic tumor cells. PMID: 28205588 The reduced urinary AGT/creatinine in Autralian Indigenous pregnant women may reflect subclinical renal dysfunction which limits the ability of the kidney to maintain sodium balance and could indicate an increased risk of pregnancy complications and/or future renal disease. PMID: 29674190 ACE2 and other enzymes can form ANG-(1-7) directly or indirectly from either the decapeptide ANG I or from ANG II. [review] PMID: 29351514 The ACE and AGT gene polymorphisms are not associated with the progress of diabetes developing into retinopathy in Chinese patients with type 2 diabetes. PMID: 29378484 AGT M235T and T174M variants contribute to an increased risk of developing preeclampsia (PE), and for M235T to PE severity. PMID: 29366364 Data, including data using network analysis, suggest that angiotensinogen (AGT), mitogen-activated protein kinase-14 (MAPK14), and prothrombin (F2) in placental villous tissues are core factors in early embryonic development; these studies involved proteomics and bioinformatics analysis of altered protein expression in placental villous tissue from early recurrent miscarriage patients in comparison to control tissues. PMID: 29277264 The AGT (M235T) gene polymorphism do not seem to have a significant effect on the development of clinical properties or cardiovascular comordities of acromegalic patients. PMID: 28712073 Angiotensin II has a role in increasing glomerular permeability by beta-arrestin mediated nephrin endocytosis PMID: 28004760 After donor nephrectomy, increasing uAGT levels can be the result of activation of the intrarenal renin-angiotensin system affecting the compensatory changes in the remaining kidney. PMID: 28988519 M235T polymorphism of the AGT gene seems unrelated to the development or the clinical course of endometriosis. PMID: 29303211 AGT missense polymorphisms are not associated with diabetic nephropathy in our subset of Slovenian type 2 diabetes mellitus patients PMID: 28488548 Association of AGT single nucleotide polymorphism rs3789678 and gestational hypertension in Chinese population. PMID: 27910864 Data suggest that angiotensin-II plays important role in development of albuminuria, particularly in subjects with impaired glucose metabolism; here, serum angiotensin-II levels are up-regulated in subjects with prediabetes and type 2 diabetes as compared to subjects with normal glucose metabolism; elevated serum angiotensin-II level may be early biomarker or risk factor for vasculitis. PMID: 28797632 The T allele of AGT may play a role in the pathogenesis of preeclampsia in South African Black women. PMID: 28641212 These data indicate that Ang II-AT2R regulates human bone marrow MSC migration by signaling through the FAK and RhoA/Cdc42 pathways. PMID: 28697804 Data suggest that up-regulaton of Ang-(1-7) levels in follicular fluid correlates with increases in number of mature oocytes retrieved upon ovarian stimulation in preparation for in vitro fertilization. PMID: 28402544 Urinary angiotensinogen and renin excretion are elevated in CKD patients. Both parameters are negatively associated with eGFR and these associations are independent of urinary albumin excretion PMID: 28395289 Reduced IL-18 serum concentration in children after HUS with no difference in its urine concentration may indicate a loss of the protective effects of this cytokine on renal function due to previously occurred HUS. PMID: 27982687 Angiotensin II initiates hepatocyte epithelial-mesenchymal transition by activating the NOX-derived H2O2-mediated NLRP3 inflammasome/IL-1ss/Smad circuit. PMID: 27445100 angiotensin II induced abdominal aortic aneurysm growth and inflammation is attenuated by imatinib PMID: 27085160 present study has demonstrated, for the first time, that high glucose augments AGT in human RPTCs through HNF-5, which provides a potential therapeutic target for diabetic nephropathy PMID: 29053707 AngII-dependent phosphorylation of LCP1 in cultured podocytes was mediated by the kinases ERK, p90 ribosomal S6 kinase, PKA, or PKC. LCP1 phosphorylation increased filopodia formation. PMID: 28768720 Autosomal dominant polycystic kidney disease (ADPKD), uniquely increases urinary angiotensinogen and renin excretion despite their circulating levels being comparable with those in non-ADPKD chronic kidney disease. PMID: 28747358 Quaternary interactions and supercoiling modulate the cooperative DNA binding of AGT. PMID: 28575445 results show that SNPs in the Hap-I of the hAGT gene promote high-fat diet-induced binding of transcription factors GR, CEBP-beta and STAT3, which lead to elevated expression of the hAGT gene in hepatic and adipose tissues PMID: 28467442 Angiotensinogen import and subsequent trafficking to the mitochondria occurs in proximal kidney tubules. PMID: 27903492 Transgenic mice expressing human AGT in the subfornical organ AGT and possibly ANG I/ANG II into the cerebral ventricles. PMID: 28490451 AngII could induce pulmonary injury by triggering endothelial barrier injury, and such process may be related to the dephosphorylation of Y685-VE-cadherin and the endothelial skeletal rearrangement PMID: 28119542 Renin-angiotensin system transgenic mouse model suggests that renal injury in preeclampsia may be mediated through local VEGF. PMID: 27927648 endoplasmic reticulum stress induces apoptosis in human alveolar epithelial cells through mediation of unfolded protein response pathways, which in turn regulate the autocrine ANGII/ANG1-7 system. PMID: 27638906 Angiotensin II stimulates PYY secretion, in turn inhibiting epithelial anion fluxes, thereby reducing net fluid secretion into the colonic lumen. PMID: 27447725 NOXs had two time-dependent reactions in response to Ang II stimulation via MAPK pathwa PMID: 27807688 increased Ang-II/Ang-(1-7) ratios may lead to Ang-II over-activation and aggravate atherosclerosis progression. PMID: 27432541 urinary angiotensinogen could be a prognostic marker of the albuminuria reduction effects of olmesartan in patients with metabolic syndrome PMID: 27801805 AGT expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267 Urinary angiotensinogen reflects intrarenal RAS status, and is of value to assess the severity of acute tubular necrosis . PMID: 27788506 Data suggest that enhanced survival of normal prostate epithelial cells (PNT1A cell line) in presence of either or both angiotensin II (Ang II) and relaxin 2 (RLN2) appears to be associated with increased ratio of BCL2/BAX messenger RNA expression; thus, Ang II and/or RLN2 appear to be involved in regulation of apoptosis in prostate epithelium. PMID: 27119161 increasing the serum levels of AngII increased the risk of acute myocardial infarction (AMI); the risk of AMI increased when the serum levels of AngII and KLK1 simultaneously increased; individuals with the combined genotypes of ACE DD and KLK1 GG showed increased risk of AMI compared with those with the combined genotypes of ACE II and KLK1 AA PMID: 27329205 genetic association study and meta-analysis revealed a significant association between M235T polymorphism of angiotensinogen and myocardial infarction risk PMID: 27586550 significant association between Thr207Met polymorphism and chronic kidney disease progression in autosomal dominant polycystic kidney disease PMID: 26482465 The aim of this work is to assess the influence of the rs1799752 polymorphism of the angiotensin-converting enzyme (ACE) gene and the rs699 polymorphism of the angiotensinogen (AGT) gene on the in-stent restenosis in Polish patients with stable coronary artery disease. PMID: 27162064 in cultured H9C2 cells and that CyPA/CD147 signaling pathway inhibition protects against Ang II-induced cardiomyocyte hypertrophy. PMID: 27590243 The circulating ACE2 and Ang-(1-7) levels were related to neither rs4646155 nor rs879922 in female or male patients.In conclusion, the rs2106809 polymorphism of the ACE2 gene may be a determinant of the circulating Ang-(1-7) level in female patients with hypertension, suggesting a genetic association between circulating Ang-(1-7) levels and ACE2 gene polymorphisms in patients with hypertension. PMID: 27310975 observed significantly higher prevalence of ACE DD and AGTR1 1166CC genotypes in hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) patients. Also, 235TT genotype of AGT (M235T) was significantly associated with enhanced risk of the disease phenotype in HCM, DCM, and RCM. PMID: 28120210 Angiotensinogen expression is down regulated in human ileal Crohn's disease, particularly in the presence of inflammation and current cigarette smoking, implicating the mesenteric vasculature and mucosal hypoxia as co-factors in ileal CD pathogenesis. PMID: 27014752 AGT M235T polymorphism was associated with SAH risk in Caucasian-Brazilians, and no association was detected with CAD PMID: 27019433 Protective role of g.5855G>A polymorphism in the development of Essential Hypertension in Indian population was reported. The results reflect possibility of ethnic variation in contribution of g.5855G>A polymorphism of the AGT gene to the disease. PMID: 27398822

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.