Recombinant Human Angiopoietin-Related Protein 4 (ANGPTL4) Protein (GST)

Name: Recombinant Human Angiopoietin-Related Protein 4 (ANGPTL4) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-03578P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ANGPTL4.

Collections: High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Angiopoietin-Related Protein 4 (ANGPTL4) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9BY76
Target Symbol	ANGPTL4
Synonyms	Angiopoietin like 4; Angiopoietin related protein 4; Angiopoietin-like protein 4; Angiopoietin-related protein 4; ANGL4_HUMAN; ANGPT L2; ANGPT L4; ANGPTL2; Angptl4; ARP4; Fasting induced adipose factor; FIAF; HARP; Hepatic angiopoietin related protein; Hepatic fibrinogen/angiopoietin related protein; Hepatic fibrinogen/angiopoietin-related protein; HFARP; NL2; Peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin related protein; PGAR; pp1158; PPARG angiopoietin related protein; PSEC0166; TGQTL; UNQ171; Weakly similar to angiopoietin 1 [H.sapiens]
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	VQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAE
Expression Range	28-403aa
Protein Length	Partial
Mol. Weight	69.6kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. May also play a role in regulating glucose homeostasis and insulin sensitivity (Probable). Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. Upon heterologous expression, inhibits the adhesion of endothelial cell to the extracellular matrix (ECM), and inhibits the reorganization of the actin cytoskeleton, formation of actin stress fibers and focal adhesions in endothelial cells that have adhered to ANGPTL4-containing ECM (in vitro). Depending on context, may modulate tumor-related angiogenesis.; Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.
Subcellular Location	Secreted. Secreted, extracellular space, extracellular matrix.
Database References	HGNC: 16039 OMIM: 605910 KEGG: hsa:51129 STRING: 9606.ENSP00000301455 UniGene: PMID: 29899519 A relevant role of ANGPTL-4 in human obesity and its involvement in long-term body weight changes. PMID: 29536615 Data indicate that the angiopoietin-like protein 4 (ANGPTL4)-mediated upregulation of tristetraprolin expression regulates the stability of chemokines in human colon epithelial cells. PMID: 28287161 The data suggest that exercise-induced ANGPTL4 is secreted from the liver and driven by a glucagon-cAMP-PKA pathway in humans. These findings link the liver, insulin/glucagon, and lipid metabolism together. PMID: 29031727 Study data support dual roles for ANGPTL4 in urothelial carcinoma progression, either as a tumor suppressor or oncogene, in response to microenvironmental context. PMID: 29035390 ANGPTL4 levels are increased in both plasma and adipose tissues of subjects with hypertension. PMID: 29490644 Low ANGPTL4 expression is associated with childhood obesity. PMID: 28733963 SNP rs11672433, a high-frequency locus in the ANGPTL4 gene, does not influence the predisposition to brain arteriovenous malformation or its effect is too small to be detected in the present size sample set. PMID: 29221972 Levels of ANGPTL4 in the circulation and HDLs were increased in type 2 diabetics altering lipid metabolism. PMID: 28645936 High expression of ANGPTL4 is associated with drug resistance in prostate cancer. PMID: 28560449 this study suggests that the presence of C allele of rs1044250 and G allele of rs2278236 in ANGPTL4 gene is associated with higher risk of moderate/severe proteinuria in renal transplant patients PMID: 27913276 These results suggested that ANGPTL4 was essential for proliferation and metastasis of lung cancer cells. PMID: 27166634 The mutant tumors exhibited impaired proliferation, anoikis resistance, and migratory capability and had reduced adenylate energy charge. Further investigations also revealed that cANGPTL4 regulated the expression of Glut2 PMID: 28641978 Data indicate angiopoietin-like 4 (ANGPTL4) as a key player that coordinates an increase in cellular energy flux crucial for EMT via an ANGPTL4/14-3-3gamma signaling axis. PMID: 28745316 The authors now show: (1) that ANGPTL4 inactivates LPL by catalyzing the unfolding of its hydrolase domain; (2) that binding to GPIHBP1 renders LPL largely refractory to this inhibition; and (3) that both the LU domain and the intrinsically disordered acidic domain of GPIHBP1 are required for this protective effect. PMID: 27929370 One of the variants, rs116843064, is a damaging missense variant within the ANGPTL4 gene. PMID: 27036123 reduced expression of one of the survival-associated transcripts, Angiopoietin-like 4, impairs growth of a gemcitabine-resistant pancreatic cancer cell line. PMID: 27282075 Serum ANGPTL4 is elevated in coronary artery disease, but levels do not reflect severity of disease. PMID: 28795637 identify ANGPTL4 as a Wnt signaling antagonist that binds to syndecans and forms a ternary complex with the Wnt co-receptor Lipoprotein receptor-related protein 6 PMID: 29017031 results suggest that ANGPTL4 could contribute to the development of retinal neovascularization in sickle cell patients and could therefore be a therapeutic target for the treatment of PSR PMID: 28832635 Data suggest that purified FLD (C-terminal fibrinogen-like domain) of ANGPTL4 is sufficient to stimulate lipolysis in primary adipocytes; increasing circulating FLD levels in mice not only induces white adipose tissue lipolysis in vivo but also reduces diet-induced obesity without affecting LPL (lipoprotein lipase) activity; increasing systemic FLD levels induces beige conversion in white adipose tissue. PMID: 28842503 enhanced expression of angiopoietin-like 4 in rheumatoid arthritis may explain the occurrence of insulin resistance, cardiovascular risk, and joint destruction [review] PMID: 28004425 Neither serum nor urine Angptl4 appear to be good biomarkers in minimal change disease. Elevated urinary Angptl4 in glomerular disease appears to reflect the degree of proteinuria rather than any specific disease. PMID: 28441404 results reveal that liganded GR spatiotemporally controls ANGPTL4 transcription in a chromosomal context. PMID: 28056052 analyzed samples from our previously published studies on ANGPL4 levels in patients on hemodialysis and patients with diabetes type 2. These samples did not show false positive reactions. The levels of ANGPTL4 were comparable to those detected previously PMID: 28107351 Oleic acid enhances head and neck squamous cell carcinoma metastasis through the ANGPTL4/fibronectin/Rac1/Cdc42 and ANGPTL4/fibronectin/MMP-9 signaling axes. PMID: 27865799 Cyclic stretching of tendon fibroblasts stimulated the expression and release of ANGPTL4 protein. PMID: 26670924 ANGPTL4 is secreted by human forearm muscle in postprandial conditions after a high-saturated fatty acid meal. Plasma ANGPTL4 concentrations were not associated with in vivo skeletal muscle LPL activity after a high-saturated fatty acid meal. Dietary fat quality affects plasma ANGPTL4, but it remains to be elucidated whether this influences short-term skeletal muscle lipid handling. PMID: 27011113 angiopoietin-like 4 plays an important role in the regulation of epidermal growth factor induced cancer metastasis PMID: 27797381 Beyond rare-variant genetic association study determined rare hypertriglyceridemia causal ANGPTL4 variants based on high throughput sequencing. PMID: 26903168 ANGPTL4 variants are associated with, not only lower fasting triglyceride levels, but also a decreased cardiovascular risk in type 2 diabetic Tunisian patients. So, T266M and E40K polymorphism predicts cardiovascular disease risk in type 2 diabetic Tunisian population. PMID: 27004807 Increased ANGPTL4 expression is associated with uveal melanoma. PMID: 26761211 This study showed that the tagged SNPs and high serum levels of ANGPTL4 are associated with large artery atherosclerotic stroke and the lipid characteristics. PMID: 26944173 ANGPTL4 mRNA expressions and serum levels were significantly higher in high grade breast carcinoma. PMID: 26745120 Knockdown of ANGPTL4 inhibits proliferation and promotes apoptosis in cervical cancer. PMID: 27053616 ANGPTL4 levels were higher in both obese and non-obese PCOS patients compared to healthy controls. PMID: 26291814 circulating ANGPTL4 levels are up-regulated in COPD patients, and have correlations with pulmonary function and systematic inflammation in COPD PMID: 26813452 Collectively, our findings indicate that miR-134 may regulate lipid accumulation and proinfiammatory cytokine secretion in macrophages by targeting the ANGPTL4 gene. PMID: 26546816 This study is the first to show that podocyte-secreted Angptl4 is upregulated in diabetic neuropathy and can be detected in urine. PMID: 25424436 Data suggest that up-regulation of plasma levels of Angptl4 (angiopoietin-like 4 protein) and LPL (lipoprotein lipase) can be used as biomarkers specific to detecting the stage of diabetic cardiovascular complications. PMID: 25597500 Hepatocellular carcinoma (HCC) tissues expressed significantly lower levels of ANGPTL4 mRNA than non-tumor tissues; copy number of ANGPTL4 gene in tumor tissues was significantly lower than in non-tumor tissues of HCC patients. Higher frequency of methylation of CpG sites of ANGPTL4 promoter was detected in tumor tissues compared to non-tumor tissues. PMID: 25148701 results demonstrate ANGPTL4 contributes to OSCC metastasis by stimulating cell invasion. ANGPTL4 is potential therapeutic target for preventing cancer metastasis. PMID: 25060575 Carriers of E40K and other inactivating mutations in ANGPTL4 had lower levels of triglycerides and a lower risk of coronary artery disease than did noncarriers. PMID: 26933753 We found that carriers of loss-of-function mutations in ANGPTL4 had triglyceride levels that were lower than those among noncarriers; these mutations were also associated with protection from coronary artery disease. PMID: 26934567 ANGPTL4 might promote metastasis and might inhibit apoptosis of colorectal cancer cells by up-regulation of BMP7. PMID: 26417691 A1AT binds to FA, and it is this form of A1AT that induces Angptl4 and FABP4 expression via a PPAR-dependent pathway. PMID: 26363050 High serum ANGPTL4 with circulating RANKL suggests that ANGPTL4 may represent a novel marker for bone destruction in rheumatoid arthritis. PMID: 25289668 results suggest targeting both ANGPTL4 and VEGF may be necessary for effective treatment or prevention of PDR and provide the foundation for studies evaluating aqueous ANGPTL4 as a biomarker to help guide individualized therapy for diabetic eye disease PMID: 26039997 plasma ANGPTL4 levels as well as ANGPTL4 variants significantly predict cardiovascular events independently of conventional cardiovascular risk factors PMID: 25463098 ANGPTL4 can both bind and inactivate lipoprotein lipase (LPL) complexed to GPIHBP1 and inactivation of LPL by ANGPTL4 greatly reduces the affinity of LPL for GPIHBP1 PMID: 25809481

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.