Recombinant Human Allograft Inflammatory Factor 1 (AIF1) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04324P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Allograft Inflammatory Factor 1 (AIF1) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04324P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Allograft Inflammatory Factor 1 (AIF1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P55008
Target Symbol AIF1
Synonyms AIF 1; AIF-1; Aif1; AIF1 protein; AIF1_HUMAN; Allograft inflammatory factor 1; Allograft inflammatory factor 1 splice variant G; allograft inflammatory factor-1 splice variant Hara-1; balloon angioplasty responsive transcription; BART 1; G1; G1 putative splice variant of allograft inflamatory factor 1; IBA 1; IBA1; interferon gamma responsive transcript; Interferon responsive transcript 1; interferon responsive transcript factor 1; Ionized calcium binding adapter molecule 1; Ionized calcium-binding adapter molecule 1; ionized calcium-binding adapter molecule; IRT 1; IRT1; Microglia response factor; MRF1; Protein g1
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Expression Range 2-147aa
Protein Length Full Length of Mature Protein
Mol. Weight 32.6kDa
Research Area Neuroscience
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.
Subcellular Location Cytoplasm, cytoskeleton. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, phagocytic cup.
Database References

HGNC: 352

OMIM: 601833

KEGG: hsa:199

STRING: 9606.ENSP00000365227

UniGene: PMID: 30188879

  • It may be speculated that Iba-1 protein besides its major function (involvement in phagocytosis) can perform the role of a transcriptional factor. PMID: 30136808
  • This study shown the AIF1 expression in Microglia and Astrocytes in stroke, Alzheimer's disease, and Lewy body dementia. PMID: 28398520
  • involved in the immunological process underlying rheumatoid arthritis PMID: 26585362
  • Using double labeling with Iba-1 and cd68 could determine the physiological state of microglia in brain contusion based on their morphology and immunoreactivity. PMID: 27442380
  • The results of our study suggest that the AIF1 gene polymorphisms have no influence on long-term kidney allograft function. PMID: 26324213
  • Data showed that AIF-1 promoted the proliferation of HepG2 cells by accelerating the activation of IGF-1R and its downstream signaling pathway, which confirms that AIF-1 plays a crucial role in the development of hepatocellular carcinoma cells. PMID: 25998745
  • AIF-1 functions as a tumor suppressor possibly by regulating beta-catenin in gastric cancer. the level of AIF-1 expression may serve as a protective prognostic indicator for gastric cancer. PMID: 24337893
  • AIF-1, which induced chemokines and enhanced chemotaxis of monocytes, may represent a molecular target for the therapy of immune-inflammatory disorders PMID: 24796669
  • The results of this study suggest a lack of association between AIF-1 gene polymorphisms and response to sulphasalazine treatment in rheumatoid arthritis. PMID: 25026748
  • The results of this study suggest that the patients with the rs2259571 CC AIF1 genotype have a poorer response to therapy with Methotrexate. PMID: 24018427
  • We are unable to find statistically significant association between COX-2 and AIF-1 gene polymorphisms and allograft survival. PMID: 23777936
  • The overexpressed AIF-1, the novel inflammatory polypeptide derived from macrophage lineages, is closely associated with atherogenesis via affecting the blood composition and promoting macrophage uptake and foam cell formation. PMID: 23867161
  • AIF-1 can protect rheumatoid arthritis fibroblast-like synoviocytes from apoptosis induced by NO by upregulating the expression of p-Akt and p-BAD. PMID: 23547889
  • daintain/AIF-1 reinforced the resistance of breast cancer cells to cisplatin by inhibition of cell apoptosis and reduction of intracellular cisplatin accumulation PMID: 23221708
  • Serum AIF-1 concentration correlated with albuminuria and eGFR in patients with type 2 diabetes and it could be a marker of diabetic nephropathy as well as activated macrophages. PMID: 22560794
  • Our results suggest that the AIF1 rs2259571 CC genotype is associated with the active form of RA. PMID: 22106834
  • The serum AIF-1 concentrations were positively correlated with levels of fasting plasma glucose, hemoglobin A1c, triglycerides, and uric acid, and with waist circumference and BMI, and were inversely correlated with HDL cholesterol levels. PMID: 22225958
  • Overexpression of AIF-1 stimulates migration and proliferation of human vascular smooth muscle cells, whereas IRT-1 exerts opposite effects. PMID: 22116621
  • Our data suggest that SNPs in or near the AIF1 locus contribute to obesity risk in the Greek population. PMID: 21720444
  • daintain/AIF-1 activates p38 MAPK signaling pathway contributing to up-regulation of TNF-alpha in MDA-MB-231 and MCF-7 cells. PMID: 21509525
  • AIF-1 shows promise that it can be a potential biomarker for cardiac allograft rejection. PMID: 20850992
  • data demonstrated that expression profiles of AIF-1 and TLR-2 correlated with biopsy-proven allograft rejection in both peripheral blood and local tissue, suggesting their potential as diagnostic biomarkers for early detection of allograft rejection PMID: 21168672
  • AIF-1 can induce IL-6 secretion on mononuclear cells and fibroblast chemotaxis. AIF-1 may accordingly provide an attractive new target for antifibrotic therapy in SSc as well as Scl GVHD. PMID: 21040744
  • findings suggest that the impact of AIF-1 on endothelial cells would stimulate angiogenesis and consequently affect the progression of infantile hemangiomas PMID: 19745784
  • AIF-1 binds and polymerizes F actin and also regulates Rac1 activity and vascular smooth muscle migration PMID: 12714565
  • more AIF-1 immunoreactive macrophages/microglial cells and, interestingly, neurones were observed in Creutzfeldt-Jakob disease patients PMID: 12887599
  • AIF-1 enhances VSMC growth by autocrine production of G-CSF, and AIF-1 expression may influence VSMC-inflammatory cell communication. PMID: 15117732
  • Genomic rearrangement of AIF1 in arteriosclerosis was studied. PMID: 15784173
  • The ability of AIF-1 to activate vascular smooth muscle is lost by mutation in the EF-hand calcium-binding region. PMID: 15922740
  • Overexpression of allograft inflammatory factor-1 is associated with development of coronary artery vasculopathy PMID: 16049345
  • These data indicate that AIF-1 mediates atherogenesis-initiated signaling and activation of macrophages. PMID: 16291819
  • The subtle regulation of allograft inflammatory factor-1 in the involution of hemangiomas will help design a new anti-angiogenic therapy for some tumors. [REVIEW] PMID: 17010532
  • The molecular conformational change induced by Ca(2+)-binding of Iba1 is different from that found in the classical EF-hand proteins, which demonstrates that Iba1 has an unique molecular switching mechanism dependent on Ca(2+)-binding. PMID: 17011575
  • AIF-1 is a novel molecular component of podocytes and the upregulation of AIF-1 in an anti-GBM nephritis model may mainly be a consequence of its expression in infiltrating cells. PMID: 17035944
  • Crystals of AIF-1 were grown at 291 K using PEG-8000 as precipitant, and diffraction extends to 3.3 A resolution. PMID: 17073733
  • association of a nonsynonymous change within the AIF-1 gene with systemic sclerosis, and linkage with TNFA alleles within 50 kb of this gene PMID: 17498268
  • a genetic association between AIF1 and the anti-centromere antibodies-positive subset of systemic sclerosis. PMID: 17522098
  • Using immunohistochemistry, we found that AIF-1 is expressed at low levels in normal skin, but is highly upregulated in various inflammatory skin disorders PMID: 17533487
  • These results suggest that AIF-1 may participate in the early pathogenesis of systemic sclerosis by promoting tissue T cell infiltration and production of cytokines capable of inducing the expression of a fibrotic phenotype in normal fibroblasts. PMID: 17907195
  • daintain/AIF-1 can promote the growth of breast tumors via activating NF-kappaB signaling, which consequently up-regulates the expression of cyclin D1. PMID: 18341653
  • The AIF1 rs2269475 T allele is associated with increased risk of rheumatoid arthritis development. PMID: 18721278
  • AIF-1 expression regulates endothelial cell activation, signal transduction, and vasculogenesis. PMID: 18787073
  • AIF-1 plays a role in inflammatory nerve disease and vascular smooth muscle cell proliferation and may be a new molecular target for treatment. PMID: 18816612
  • Genetic variants of the HLA-A, HLA-B and AIF1 loci show independent associations with type 1 diabetes in Norwegian families PMID: 18987644

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Sale
    SDS-PAGE analysis of Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein, CAT# BLT-08014P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein
    • Molecule: CEBPB;
    • Species: Mouse;
    • Expression system: E.coli;
    • Tag: N-His-GST;
    • Sequence: 1-296aa;
    CAT#: BLT-08014P

    Save $50
    Sale
    SDS-PAGE analysis of Human BAX (Apoptosis Regulator Bax) - Recombinant Protein, CAT# BLT-07419P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human BAX (Apoptosis Regulator Bax) - Recombinant Protein
    • Molecule: BAX;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-171aa;
    CAT#: BLT-07419P

    Save $50
    Recently viewed