Recombinant Human Aldehyde Dehydrogenase X, Mitochondrial (ALDH1B1) Protein (His-GST&V5-Myc)

Name: Recombinant Human Aldehyde Dehydrogenase X, Mitochondrial (ALDH1B1) Protein (His-GST&V5-Myc)
Brand: Beta LifeScience
SKU: BLC-07195P
Availability: InStock

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Aldehyde Dehydrogenase X, Mitochondrial (ALDH1B1) Protein (His-GST&V5-Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P30837
Target Symbol	ALDH1B1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-GST&C-V5-Myc
Target Protein Sequence	SRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSY
Expression Range	167-264aa
Protein Length	Partial
Mol. Weight	47.6 kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.
Subcellular Location	Mitochondrion matrix.
Protein Families	Aldehyde dehydrogenase family
Database References	HGNC: 407 OMIM: 100670 KEGG: hsa:219 STRING: 9606.ENSP00000366927 UniGene: Hs.436219
Tissue Specificity	Liver, testis and to a lesser extent in brain.

Gene Functions References

These results suggest that ALDH1B1 is a novel human colorectal cancer biomarker PMID: 28881356
The aims of this study were: (i) to use bioinformatic techniques to characterize the possible effects of selected variants in ALDH1B1 on protein structure and function; and, (ii) to genotype three missense and one stop-gain, protein-altering, non-synonymous single nucleotide polymorphisms in 1478 alcohol dependent cases and 1254 controls of matched British and Irish ancestry. PMID: 28594837
ALDH1B1 is expressed at very high levels in human pancreatic cancer, and it contributes to proliferation in these tumor cells. PMID: 26566217
High expression of ALDH1A2 and ALDH1B1 mRNA was found to be significantly correlated to worser survival in all NSCLC patients. PMID: 26366059
Data show that ALDH1B1 may promote colon cancer tumorigenesis by modulating the Wnt/beta-catenin, Notch and PI3K/Akt signaling pathways. PMID: 25950950
ALDH1B1 metabolizes nitroglycerin and all-trans-retinaldehyde. One of the three human polymorphisms, ALDH1B1*2, is catalytically inactive, likely due to poor NAD(+) binding. PMID: 25413692
ALDH1B1 SNPs play a role in shaping the alcohol drinking patterns among the Inuit in Greenland. PMID: 25311581
ALDH1 is indicative of stemness and is a biomarker marker in colon cancer. PMID: 24953984
ALDH1B1 is more profoundly expressed in the adenocarcinomas examined in this study relative to ALDH1A1 and that ALDH1B1 is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer. PMID: 21216231
An ALDHX model based on the crystal structure of human ALDH2, reveals similarities with the previously described ALDH structures. Analyses indicate a close structural and functional relationship between the two isoenzymes of human origin PMID: 20955166
a common SNP encoding ALDH1b1 (rs2228093) was found to be significantly associated with alcohol-induced hypersensitivity. PMID: 20205700
ALDH1b1 ala69val was associated with diastolic blood pressure in a Caucasian population sample PMID: 18782342

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.