Recombinant Human Adiponectin Receptor Protein 1 (ADIPOR1)
Beta LifeScience
SKU/CAT #: BLC-07568P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Adiponectin Receptor Protein 1 (ADIPOR1)
Beta LifeScience
SKU/CAT #: BLC-07568P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Adiponectin Receptor Protein 1 (ADIPOR1) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q96A54 |
| Target Symbol | ADIPOR1 |
| Synonyms | ADIPOR1; PAQR1; TESBP1A; CGI-45; Adiponectin receptor protein 1; Progestin and adipoQ receptor family member 1; Progestin and adipoQ receptor family member I |
| Species | Homo sapiens (Human) |
| Expression System | in vitro E.coli expression system |
| Tag | Tag-Free |
| Target Protein Sequence | EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL |
| Expression Range | 89-375aa |
| Protein Length | Partial |
| Mol. Weight | 33.0 kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. |
| Protein Families | ADIPOR family |
| Database References | HGNC: 24040 OMIM: 607945 KEGG: hsa:51094 STRING: 9606.ENSP00000341785 UniGene: PMID: 29761507 |
