Recombinant Human C-C Motif Chemokine 24 (CCL24) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08416P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human C-C Motif Chemokine 24 (CCL24) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08416P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human C-C Motif Chemokine 24 (CCL24) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O00175 |
Target Symbol | CCL24 |
Synonyms | C C motif chemokine 24; C-C motif chemokine 24; CCL24; CCL24_HUMAN; Chemokine CC Motif Ligand 24; CK beta 6; CK-beta-6; Ckb6; Eosinophil chemotactic protein 2; Eotaxin-2; MPIF 2; MPIF-2; MPIF2; Myeloid progenitor inhibitory factor 2; SCYA24; Small inducible cytokine A24; Small inducible cytokine subfamily A (Cys-Cys) member 24 ; Small-inducible cytokine A24 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC |
Expression Range | 27-119aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 14.5kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3. |
Subcellular Location | Secreted. |
Protein Families | Intercrine beta (chemokine CC) family |
Database References | HGNC: 10623 OMIM: 602495 KEGG: hsa:6369 STRING: 9606.ENSP00000222902 UniGene: PMID: 28042950 |