Recombinant Human Adenosine Deaminase Cecr1 (CECR1) Protein (His-GST&Myc)
Beta LifeScience
SKU/CAT #: BLC-07448P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Adenosine Deaminase Cecr1 (CECR1) Protein (His-GST&Myc)
Beta LifeScience
SKU/CAT #: BLC-07448P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Adenosine Deaminase Cecr1 (CECR1) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9NZK5 |
| Target Symbol | CECR1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His-GST&C-Myc |
| Target Protein Sequence | ELSGEHHDEEWSVKTYQEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSY |
| Expression Range | 254-453aa |
| Protein Length | Partial |
| Mol. Weight | 57.5 kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity. |
| Subcellular Location | Secreted. |
| Protein Families | Metallo-dependent hydrolases superfamily, Adenosine and AMP deaminases family, ADGF subfamily |
| Database References | HGNC: 1839 OMIM: 182410 KEGG: hsa:51816 STRING: 9606.ENSP00000262607 UniGene: PMID: 27130863 |
