Recombinant Human Acetylserotonin O-Methyltransferase (ASMT) Protein (His&Myc)

Name: Recombinant Human Acetylserotonin O-Methyltransferase (ASMT) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-04826P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Acetylserotonin O-Methyltransferase (ASMT) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P46597
Target Symbol	ASMT
Synonyms	acetylserotonin methyltransferase (Y chromosome); acetylserotonin N-methyltransferase; Acetylserotonin O-methyltransferase; ASMT; ASMTY; HIOM_HUMAN; HIOMT; HIOMTY; Hydroxyindole O-methyltransferase; OTTHUMP00000022834; OTTHUMP00000022835; OTTHUMP00000022836
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK
Expression Range	1-345aa
Protein Length	Full Length
Mol. Weight	45.9 kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Isoform 1 catalyzes the transfer of a methyl group onto N-acetylserotonin, producing melatonin (N-acetyl-5-methoxytryptamine). Isoform 2 and isoform 3 lack enzyme activity.
Protein Families	Class I-like SAM-binding methyltransferase superfamily, Cation-independent O-methyltransferase family
Database References	HGNC: 750 OMIM: 300015 KEGG: hsa:438 UniGene: PMID: 26510398 two single nucleotide polymorphisms (rs4446909 and rs5989681)in the promoter of ASMT do not contribute to the pathogenesis of schizophrenia in Chinese-Han subjects PMID: 26154813 results indicate that expression of sleep onset delay relates to melatonin pathway genes. PMID: 25059483 These data suggest a relationship between decreased mRNA and protein expression levels of ASMT gene and cognitive impairment. PMID: 24881886 Bipolar disorder-associated SNP influences sleep and circadian rhythms in bipolar patients in remission and controls. PMID: 24308489 study presents the X-ray crystal structure of ASMT; analysis of nonsynonymous variants found that the majority of these mutations reduced or abolished ASMT activity; estimate the allelic frequency of ASMT deleterious mutations ranges from 0.66% in Europe to 2.97% in Asia PMID: 22775292 results support the possible involvement of the ASMT gene in autism spectrum disorders PMID: 23995775 ASMT might be a susceptibility gene for autism PMID: 23349736 Rare and common variations in ASMT might play a role in bipolar disorder vulnerability. PMID: 22694957 Data found a splice site mutation in ASMT (IVS5+2T>C) and one stop mutation in MTNR1A (Y170X) - detected exclusively in patients with ADHD - for which biochemical analyses indicated that they abolish the activity of ASMT and MTNR1A. PMID: 21615493 The expression of HIOMT in epithelial cells of striated ducts in human submandibular glands. PMID: 21437622 study of genetic variability of ASMT in a cohort of patients with intellectual disability (ID)and controls; identifed patients with deleterious ASMT mutations and decreased ASMT activity; however, study does not support ASMT as a causative gene for ID PMID: 21251267 Results show the AA genotype and the GG genotype of ASMT were associated with lower risk for having recurrent depressive disorder. In turn, patients with depression were characterised by reduced mRNA expression for ASMT. PMID: 20433639 The results of this study indicated that HIOMT immunohistochemistry may be useful for the diagnosis of PPTs and be a prognostic factor in pineal parenchymal cell tumors. PMID: 20418777 Two polymorphisms located in the acetylserotonin methyltransferase (ASMT)promoter were more frequent in autism spectrum disorders (ASD); analyses revealed a highly significant decrease in ASMT activity and melatonin level in individuals with ASD. PMID: 17505466 The data of this study does not support a correleation between asmt gene and autism. PMID: 17957233

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.