Recombinant Enterobacteria Phage T4 Double-Stranded Dna-Binding Protein (DSBA) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05271P
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) dsbA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) dsbA.
Recombinant Enterobacteria Phage T4 Double-Stranded Dna-Binding Protein (DSBA) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05271P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Enterobacteria Phage T4 Double-Stranded Dna-Binding Protein (DSBA) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P13320 |
| Target Symbol | DSBA |
| Synonyms | dsbA; rpbBDouble-stranded DNA-binding protein; DsDNA-binding protein A |
| Species | Enterobacteria phage T4 (Bacteriophage T4) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK |
| Expression Range | 1-89aa |
| Protein Length | Full Length |
| Mol. Weight | 17.8 kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May play a role in transcription of several T4 genes. Binds double-stranded DNA and interacts preferentially with T4 late promoter regions. |
| Database References | KEGG: vg:1258620 |
