Recombinant E.Coli S-Ribosylhomocysteine Lyase (LUXS) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04404P
Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli S-Ribosylhomocysteine Lyase (LUXS) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04404P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli S-Ribosylhomocysteine Lyase (LUXS) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P45578 |
| Target Symbol | LUXS |
| Synonyms | luxS; ygaG; b2687; JW2662; S-ribosylhomocysteine lyase; EC 4.4.1.21; AI-2 synthesis protein; Autoinducer-2 production protein LuxS |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI |
| Expression Range | 2-171aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 23.3 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in the synthesis of autoinducer 2 (AI-2) which is secreted by bacteria and is used to communicate both the cell density and the metabolic potential of the environment. The regulation of gene expression in response to changes in cell density is called quorum sensing. Catalyzes the transformation of S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentadione (DPD). |
| Protein Families | LuxS family |
| Database References | KEGG: ecj:JW2662 STRING: 316385.ECDH10B_2854 |
Gene Functions References
- study demonstrated that luxS affects the expression of flagella and Stx2e toxin, 2 important STEC virulence factors PMID: 24848979
- LuxS contributes to virulence in avian pathogenic Escherichia coli O78:K80:H9. PMID: 23958403
- Proteomic profiling of luxS mutants showed only a few proteins were differentially expressed and those that were altered suggested a metabolic rather than communication role for the E. coli luxS gene product. PMID: 23651217
- Deletion of the luxS gene reduced the bacterial virulence by 31.5-fold in ducklings. PMID: 23046700
- Polyphosphate degradation in stationary phase triggers biofilm formation via LuxS quorum sensing system in Escherichia coli. PMID: 23226268
- Pfs and LuxS synthesize AI-2 in vitro from S-ribosylhomocysteine. PMID: 23236852
- luxS deletion significantly increases swimming motility and flagella synthesis in Escherichia coli K12. PMID: 20875395
- These data are consistent with the function of LuxS as an important metabolic enzyme but appear not to support the role of AI-2 as a true signal molecule for E. coli W3110 under the investigated conditions. PMID: 16321939
- The active form of LuxS contains a metal-bound water and a thiolate ion at Cys-83, consistent with the proposed roles of the metal ion (Lewis acid) and Cys-83 (general acid/base) during catalysis. PMID: 17014073
