Recombinant E.Coli Putative Monooxygenase Ydhr (YDHR) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11217P
Greater than 85% as determined by SDS-PAGE.
Recombinant E.Coli Putative Monooxygenase Ydhr (YDHR) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11217P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli Putative Monooxygenase Ydhr (YDHR) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P0ACX3 |
| Target Symbol | YDHR |
| Synonyms | ydhR; b1667; JW1657; Putative monooxygenase YdhR; EC 1.-.-.- |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MATLLQLHFAFNGPFGDAMAEQLKPLAESINQEPGFLWKVWTESEKNHEAGGIYLFTDEKSALAYLEKHTARLKNLGVEEVVAKVFDVNEPLSQINQAKLA |
| Expression Range | 1-101aa |
| Protein Length | Full Length |
| Mol. Weight | 18.3 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May function as monooxygenase and play a role in the metabolism of aromatic compounds. |
| Database References | KEGG: ecj:JW1657 STRING: 316385.ECDH10B_1801 |
Gene Functions References
- ydhR likely belongs to a recently identified group of mono-oxygenase proteins PMID: 16260765
