Recombinant E.Coli Peptidyl-Trna Hydrolase (PTH) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08978P
Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli Peptidyl-Trna Hydrolase (PTH) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08978P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli Peptidyl-Trna Hydrolase (PTH) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P0A7D1 |
| Target Symbol | PTH |
| Synonyms | pth; b1204; JW1195; Peptidyl-tRNA hydrolase; PTH; EC 3.1.1.29 |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLTKATNRLHAFKAQ |
| Expression Range | 1-194aa |
| Protein Length | Full Length |
| Mol. Weight | 25.1kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis. Involved in lambda inhibition of host protein synthesis. PTH activity may, directly or indirectly, be the target for lambda bar RNA leading to rap cell death. |
| Subcellular Location | Cytoplasm. |
| Protein Families | PTH family |
| Database References | KEGG: ecj:JW1195 STRING: 316385.ECDH10B_1257 |
Gene Functions References
- Study identifies the amino acid residues involved in the tRNA moiety recognition and also revealed the mechanism by which Pth accepts the diverse sequences of the elongator-tRNAs as substrate components. PMID: 22923517
- crystals of peptidyl-tRNA hydrolase belonged to the hexagonal space group P6(1), with unit-cell parameters a = b = 55.1, c = 413.1 A PMID: 22139168
- Possible mechanism for the suppression of thermosensitivity of pth(Ts) mutants through tRNALys overproduction. PMID: 16540595
