Recombinant E.Coli O157:H7 Translocated Intimin Receptor Tir (TIR) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09449P
Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli O157:H7 Translocated Intimin Receptor Tir (TIR) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09449P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli O157:H7 Translocated Intimin Receptor Tir (TIR) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | C6UYL8 |
| Target Symbol | TIR |
| Synonyms | tir; espE; ECSP_4676; Translocated intimin receptor Tir; Secreted effector protein Tir |
| Species | Escherichia coli O157:H7 (strain TW14359 / EHEC) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | QALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELKVSSGAG |
| Expression Range | 252-362aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 27.8kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Multifunctional protein that is required for efficient pedestal formation in host epithelial cells during infection. The extracellular region acts as a receptor for bacterial intimin, allowing the bacterium to attach tightly to the host-cell surface. Simultaneously, the intracellular region initiates a signaling cascade in the host cell, which leads to actin polymerization and formation of actin pedestals at the sites of bacterial adhesion. |
| Subcellular Location | Secreted. Host cell membrane; Multi-pass membrane protein. |
| Protein Families | Tir receptor family |
| Database References | KEGG: etw:ECSP_4676 |
