Recombinant E.Coli Glc Operon Transcriptional Activator (GLCC) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09368P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) glcC.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) glcC.
Recombinant E.Coli Glc Operon Transcriptional Activator (GLCC) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09368P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli Glc Operon Transcriptional Activator (GLCC) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P0ACL6 |
| Target Symbol | GLCC |
| Synonyms | glcC; c3710; Glc operon transcriptional activator; Glc regulatory protein; HTH-type transcriptional regulator GlcC |
| Species | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MKDERRPICEVVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGIIETAQGRDSRVARLNRVQDTSPLIHLFSTQPRTLYDLLDVRALLEGESARLAATLGTQADFVVITRCYEKMLAASENNKEISLIEHAQLDHAFHLAICQASHNQVLVFTLQSLTDLMFNSVFASVNNLYHRPQQKKQIDRQHARIYNAVLQRLPHVAQRAARDHVRTVKKNLHDIELEGHHLIRSAVPLEMNLS |
| Expression Range | 1-254aa |
| Protein Length | Full Length |
| Mol. Weight | 44.8kDa |
| Research Area | Microbiology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Transcriptional activator of the glcDEFGB operon which is associated with glycolate utilization, and encodes malate synthase G and the genes needed for glycolate oxidase activity. Also negatively regulates the transcription of its own gene. Glycolate acts as an effector, but GlcC can also use acetate as an alternative effector. |
| Database References | KEGG: ecc:c3710 STRING: 199310.c3710 |
