Recombinant E.coli Ditrans,polycis-undecaprenyl-diphosphate synthase (ISPU) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08992P
Greater than 90% as determined by SDS-PAGE.
Recombinant E.coli Ditrans,polycis-undecaprenyl-diphosphate synthase (ISPU) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08992P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.coli Ditrans,polycis-undecaprenyl-diphosphate synthase (ISPU) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P60472 |
| Target Symbol | ISPU |
| Synonyms | ispU; rth; uppS; yaeS; b0174; JW0169; Ditrans,polycis-undecaprenyl-diphosphate synthase; (2E,6E)-farnesyl-diphosphate specific; EC 2.5.1.31; Ditrans,polycis-undecaprenylcistransferase; Undecaprenyl diphosphate synthase; UDS; Undecaprenyl pyrophosphate synthase; UPP synthase |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFGGTEPGDETA |
| Expression Range | 1-253aa |
| Protein Length | Full Length |
| Mol. Weight | 32.4 kDa |
| Research Area | Microbiology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Generates ditrans,octacis-undecaprenyl pyrophosphate (UPP) from isopentenyl pyrophosphate (IPP) and farnesyl diphosphate (FPP). UPP is the precursor of glycosyl carrier lipid in the biosynthesis of bacterial cell wall polysaccharide components such as peptidoglycan and lipopolysaccharide. |
| Protein Families | UPP synthase family |
| Database References | KEGG: ecj:JW0169 STRING: 316385.ECDH10B_0154 |
Gene Functions References
- Unlike the sequential mechanism used by trans-prenyltransferases, these data demonstrate E. coli UPPS utilizes the concerted mechanism. PMID: 20828539
- L85, L88 or F89 are important for substrate binding but not specificity. The upper portion of the active-site tunnel, where cis double bonds of the product reside, may be critical for determining the final product chain length. PMID: 15447632
- undecaprenyl pyrophosphate synthase (UPPs)is crystallized in a new trigonal unit cell with Mg(2+)/isopentenyl pyrophosphates (IPP)/farnesyl thiopyrophosphate bound to the active site PMID: 15788389
