Recombinant E.Coli Cell Division Protein Zipa (ZIPA) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10655P
Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli Cell Division Protein Zipa (ZIPA) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10655P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli Cell Division Protein Zipa (ZIPA) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P77173 |
| Target Symbol | ZIPA |
| Synonyms | zipA; b2412; JW2404; Cell division protein ZipA; FtsZ interacting protein A |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMKSKRDDDSYDEDVEDDEGVGEVRVHRVNHAPANAQEHEAARPSPQHQYQPPYASAQPRQPVQQPPEAQVPPQHAPHPAQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVAEPAPVMDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA |
| Expression Range | 1-328aa |
| Protein Length | Full Length |
| Mol. Weight | 52.5kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Essential cell division protein that stabilizes the FtsZ protofilaments by cross-linking them and that serves as a cytoplasmic membrane anchor for the Z ring. Also required for the recruitment to the septal ring of the downstream cell division proteins FtsK, FtsQ, FtsL and FtsN. ZipA overproduction protects FtsZ from degradation by ClpP by preventing recognition by ClpX. Does not affect the GTPase activity of FtsZ. |
| Subcellular Location | Cell inner membrane; Single-pass type I membrane protein. |
| Protein Families | ZipA family |
| Database References | KEGG: ecj:JW2404 STRING: 316385.ECDH10B_2577 |
Gene Functions References
- study demonstrates a link between amino acid metabolism and ZipA, another essential cell division protein that binds directly to FtsZ and tethers it to the cytoplasmic membrane PMID: 29061666
- YciB protein directly interacted with ZipA. Furthermore, the septum localization of ZipA, an essential protein of cell division, is disturbed in a DeltayciB mutant PMID: 26391555
- A mutation in the promoter region of zipA, a component of the divisome, suppresses the shape defect of RodZ-deficient cells. PMID: 23922320
- Data suggest a functional scenario in which ZipA acts as a flexible tether anchoring bacterial proto-ring elements to the membrane during the earlier stages of division. PMID: 23660966
