Recombinant E.Coli 3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 1 (FABB) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08977P

Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli 3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 1 (FABB) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08977P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant E.Coli 3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 1 (FABB) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P0A953 |
Target Symbol | FABB |
Synonyms | fabB; fabC; b2323; JW23203-oxoacyl-[acyl-carrier-protein] synthase 1; EC 2.3.1.41; 3-oxoacyl-[acyl-carrier-protein] synthase I; Beta-ketoacyl-ACP synthase I; KAS I |
Species | Escherichia coli (strain K12) |
Expression System | E.coli |
Tag | N-6His&C-Myc |
Target Protein Sequence | MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD |
Expression Range | 1-406aa |
Protein Length | Full Length |
Mol. Weight | 49.3kDa |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Involved in the type II fatty acid elongation cycle. Catalyzes the elongation of a wide range of acyl-ACP by the addition of two carbons from malonyl-ACP to an acyl acceptor. Can also use unsaturated fatty acids. Catalyzes a key reaction in unsaturated fatty acid (UFA) synthesis, the elongation of the cis-3-decenoyl-ACP produced by FabA. Can use acyl chains from C-6 to C-14. Has an absolute requirement for an ACP substrate as the acyl donor, and no activity is detected when both substrates are based on CoA. |
Subcellular Location | Cytoplasm. |
Protein Families | Beta-ketoacyl-ACP synthases family |
Database References | KEGG: ecj:JW2320 STRING: 316385.ECDH10B_2485 |