Recombinant Drosophila Melanogaster Camp-Dependent Protein Kinase Catalytic Subunit (PKA-C1) Protein (His-SUMO)

Name: Recombinant Drosophila Melanogaster Camp-Dependent Protein Kinase Catalytic Subunit (PKA-C1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09485P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Drosophila Melanogaster Camp-Dependent Protein Kinase Catalytic Subunit (PKA-C1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P12370
Target Symbol	PKA-C1
Synonyms	Pka-C1; CdkA; DC0; CG4379; cAMP-dependent protein kinase catalytic subunit 1; PKA C; EC 2.7.11.11; Protein kinase DC0
Species	Drosophila melanogaster (Fruit fly)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	GNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
Expression Range	2-353aa
Protein Length	Full Length of Mature Protein
Mol. Weight	56.7kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Serine/threonine-protein kinase involved in memory formation. Promotes long-term memory by phosphorylating meng and by regulating CrebB protein stability and activity. As part of ethanol response in the glia, mediates ethanol-induced structural remodeling of actin cytoskeleton and perineurial membrane topology when anchored to the membrane.
Protein Families	Protein kinase superfamily, AGC Ser/Thr protein kinase family, cAMP subfamily
Database References	KEGG: dme:Dmel_CG4379 STRING: 7227.FBpp0079448 UniGene: Dm.2136
Tissue Specificity	More abundant in adult head than adult body.

Gene Functions References

Hedgehog signalling activation causes PKA to switch its substrates from Ci to Smo within the Hh signalling complex. PMID: 25289679
tightly controlled dose-dependent intra-neuronal PKA activity levels are critical in determining the dendritic arbor complexity, one of the possible ways being through the regulation of organelle distribution. PMID: 25017992
Alpha- NAC is a substrate of PKA following Parathyroid Hormone signaling. PMID: 24550008
that manipulations that increase cAMP/PKA signaling in adipokinetic hormone (AKH)-producing cells at the base of the neuroendocrine ring gland restore the dNf1 growth deficiency. PMID: 24278035
Acute expression of protein kinase A inhibitory peptide in aged animals is sufficient to reverse age-related memory impairment in wild-type animals. PMID: 21084612
Two-dimensional gel electrophoresis, (32)P labelling and immunodetection show that "in vitro" PKA phosphorylates the serine in the C-terminus of the NDUFS4 subunit in isolated bovine complex I. PMID: 20433953
Its signaling underlies age-related memory impairment.(review) PMID: 18646611
We found that decreased PKA activity in neurons rendered flies insensitive to the wake-promoting effects of octopamine. PMID: 18799671

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.