Recombinant Dog Epididymal Secretory Protein E1 (NPC2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08110P
Greater than 90% as determined by SDS-PAGE.
Recombinant Dog Epididymal Secretory Protein E1 (NPC2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08110P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Dog Epididymal Secretory Protein E1 (NPC2) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q28895 |
| Target Symbol | NPC2 |
| Synonyms | NPC2; NPC intracellular cholesterol transporter 2; Epididymal secretory protein E1; cE1; Niemann Pick type C2 protein homolog |
| Species | Canis lupus familiaris (Dog) (Canis familiaris) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG |
| Expression Range | 22-149aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 30.0kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the lysosomal compartment. Unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes is transferred by NPC2 to the cholesterol-binding pocket in the N-terminal domain of NPC1. May bind and mobilize cholesterol that is associated with membranes. NPC2 binds cholesterol with a 1:1 stoichiometry. Can bind a variety of sterols, including lathosterol, desmosterol and the plant sterols stigmasterol and beta-sitosterol. The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport. |
| Subcellular Location | Secreted. Endoplasmic reticulum. Lysosome. |
| Protein Families | NPC2 family |
| Database References | STRING: 9615.ENSCAFP00000024889 UniGene: Cfa.3781 |
| Tissue Specificity | Epididymis. High levels are found in the caput and corpus regions. Weaker levels in the distal cauda and in the efferent ducts. |
