Recombinant Cyriopagopus Schmidti Tau-Theraphotoxin-Hs1A (TAU-TRTX-HS1A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11169P
Greater than 85% as determined by SDS-PAGE.
Recombinant Cyriopagopus Schmidti Tau-Theraphotoxin-Hs1A (TAU-TRTX-HS1A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11169P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Cyriopagopus Schmidti Tau-Theraphotoxin-Hs1A (TAU-TRTX-HS1A) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P0CH43 |
| Target Symbol | P0CH43 |
| Synonyms | Tau-theraphotoxin-Hs1a; Tau-TRTX-Hs1a; Double-knot toxin; DkTx |
| Species | Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | DCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTNCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYRGRND |
| Expression Range | 1-79aa |
| Protein Length | Full Length |
| Mol. Weight | 13.1 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Selectively activates the heat-activated TRPV1 channel. It binds to TRPV1 in an open state-dependent manner, trapping it there to produce irreversible currents. It binds to the outer edge of the external pore of TRPV1 in a counterclockwise configuration, using a limited protein-protein interface and inserting hydrophobic residues into the bilayer. It also partitions naturally into membranes, with the two lobes exhibiting opposing energetics for membrane partitioning (K1) and channel activation (K2). In addition, the toxin disrupts a cluster of hydrophobic residues behind the selectivity filter that are critical for channel activation. |
| Subcellular Location | Secreted. |
| Protein Families | Huwentoxin-1 family, Double-knot toxin subfamily |
| Tissue Specificity | Expressed by the venom gland. |
