Recombinant Cynomolgus Monkey Zymogen Granule Protein 16 Homolog B (ZG16B) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05714P
Recombinant Cynomolgus Monkey Zymogen Granule Protein 16 Homolog B (ZG16B) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05714P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Cynomolgus Monkey Zymogen Granule Protein 16 Homolog B (ZG16B) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | 1. Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody , the EC50 is 20.15-28.98 ng/mL. |
| Uniprotkb | XP_005591053 |
| Target Symbol | ZG16B |
| Species | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Expression System | Mammalian cell |
| Tag | C-10His |
| Target Protein Sequence | MHRPEAMLLLLTLALLGGPTWAGKMYGPGGGKYFTTTEDYDHEITGLRVSVGLLLVKSVQVKLGDTWDVKQGASGGNTQEVTLQPGEYITKVFVAFQTFLRGMVLYTSKDRTFYFGKLDGQIFSVYPSQEGQVLVGIYGQYGLLGIKSIGFEWNYPLEEPTTEPPVTVT |
| Expression Range | 23-169aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 17.6 kDa |
| Research Area | Cancer |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
