Recombinant Cynomolgus Monkey Erythropoietin (EPO) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10681P
Greater than 90% as determined by SDS-PAGE.
Recombinant Cynomolgus Monkey Erythropoietin (EPO) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10681P
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Epo protein: target overview, research applications, and selection guide, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Recombinant proteins fall special offers - full-length proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Cynomolgus Monkey Erythropoietin (EPO) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P07865 |
| Target Symbol | EPO |
| Synonyms | EPOErythropoietin |
| Species | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR |
| Expression Range | 28-192aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 20.2kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3. |
| Subcellular Location | Secreted. |
| Protein Families | EPO/TPO family |
| Database References | UniGene: Mfa.5395 |
| Tissue Specificity | Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals. |
