Recombinant Cynomolgus monkey 5T4 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3590P
Recombinant Cynomolgus monkey 5T4 Protein (Tagged)

Recombinant Cynomolgus monkey 5T4 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3590P
Catalog No.: BLA-3590P

Product Overview

Host Species Cynomolgus monkey
Accession Q4R8Y9
Synonym 5T4 5T4 oncofetal antigen 5T4 oncofetal trophoblast glycoprotein 5T4 oncotrophoblast glycoprotein 5T4AG AW495680 M6P1 TPBG TPBG_HUMAN Trophoblast glycoprotein
Description Recombinant Cynomolgus monkey 5T4 Protein (Tagged) was expressed in Mammalian. It is a Protein fragment
Source Mammalian
AA Sequence TSSASSSSSSAPFLASAASAQPPLPDQCPALCECSEAARTVKCVNRNLTE VPTDLPLYVRNLFLTGNQLAVLPAGAFARRPPLAELAALNLSGSRLDEVR GGAFEHLPSLRQLDLSHNPLAYLSPFAFSGSNASISAPSPLVELILNHIV PPDDKRQNRSFEGMVAAALVAGRALQGLHLLELASNHFLYLPRDVLAQLP SLRYLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGL PHVRVFLDNNPWVCDCHMADMVTWLKQTGVVQGKDRLTCAFPEKMRNRVL LELNSADLDCDPILPPSLQTS
Molecular Weight 40 kDa including tags
Purity >90% by SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed