Recombinant Cow S100A9 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7711P
Recombinant Cow S100A9 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7711P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Cow |
Accession | P28783 |
Synonym | Leukocyte L1 complex heavy chain 60B8AG CAGB Calgranulin B Calgranulin-B Calprotectin L1H subunit CFAG CGLB Cystic fibrosis antigen B L1AG Leukocyte L1 complex heavy chain LIAG MAC387 MIF Migration inhibitory factor related protein 14 Migration inhibitory factor-related protein 14 MRP 14 MRP-14 MRP14 Myeloid-related protein 14 NIF OTTHUMP00000015331 p14 Protein S100-A9 S100 A9 S100 calcium binding protein A9 S100 calcium binding protein A9 calgranulin B S100 calcium-binding protein A9 S100A9 S10A9_HUMAN |
Description | Recombinant Cow S100A9 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | EDKMSQMESSIETIINIFHQYSVRLGHYDTLIQKEFKQLVQKELPNFLKK QKKNEAAINEIMEDLDTNVDKQLSFEEFIMLVARLTVASHEEMHNTAPPG QGHRHGPGYGKGGSGSCSGQGSPDQGSHDLGSHGHGHGHSHGGHGHSHGG HGHSH |
Molecular Weight | 35 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |