Recombinant Chlamydomonas reinhardtii Autolysin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3569P
Recombinant Chlamydomonas reinhardtii Autolysin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3569P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Chlamydomonas reinhardtii |
Accession | P31178 |
Description | Recombinant Chlamydomonas reinhardtii Autolysin Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | EIYAGKPIDLRTIVYIMDFSSCKLSGWSAPATLTPEKVTSDMLRGASAPT NNLANYYGACSYEKTLFNPDNFLVLGPVPVPCIGGVTPPPRPPRPPRPPP RAGSTISSLSRRNDTYDDWWDLSKYCTASEQQAWERAAEAYAQAIVAQDP NSATGKKLQGILQWRERRRNIYILPPGVKCSWSGYADVTCTSATCSAYVR GYSDTNAMQVIMHEAMHNYGLEHAGRGTLEYGDATDVMGDFNKAGKGLLC PNAPNMYRIGWAKPINEPGVAPFQNATGAWGNLTAANFTTDPWIRGLVIP AQGTRDDNMIVVNVGAQSTRDGAMKATGAQAYYFSYRIKNTTAGGYDSGL TLDFHKKVLVHAYNGIQSERVFGFKSNLLDWGPNFQSRSNTWTSPFLAYN NGLGGGVRLVVQSTSDTQAVVDICRISENGKELSCDDGIDNDCDGLQDNE DPDCQ |
Molecular Weight | 66 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Mediates digestion of the cell walls of the 2 mating type gametes during mating as a necessary prelude to cell fusion. This enzyme acts specifically on the framework proteins (inner wall) of the cell wall, cleaving several model peptides at specific sites. |
Subcellular Location | Periplasm. Secreted, cell wall. Note=Stored in the periplasm of gametes until its release. Secreted concurrently with release of the cell walls. |
Protein Families | Peptidase M11 family |