Recombinant B. subtilis Penicillin-binding Protein 4 (His tag)
Beta LifeScience
SKU/CAT #: BLA-3531P
Recombinant B. subtilis Penicillin-binding Protein 4 (His tag)
Beta LifeScience
SKU/CAT #: BLA-3531P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Bacillus subtilis |
Accession | P40750 |
Description | Recombinant B. subtilis Penicillin-binding Protein 4 (His tag) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | PNNPTLYDPLKHFDYTKSRQERLLKGLKDAGVITDKELKKAVKQKIKLDV EKREDKYPDYVSYVNDEFTQLVSESEGFDKRLQKASGKQKEKIENELSAR VSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGAAVINHQTHQI IALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTID ASKFCSKDYCPQNYNNRTYGTVTLDTAFKNSYNTPAIR |
Molecular Weight | 43 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits) (Probable). Has a partially redundant function with PBP-2A (pbpA) during spore outgrowth. |
Subcellular Location | Cell membrane; Peripheral membrane protein. |
Protein Families | Glycosyltransferase 51 family; Transpeptidase family |
Database References | KEGG: bsu:BSU31490 STRING: 224308.Bsubs1_010100017116 |