Recombinant B. pertussis Adenylate Cyclase Protein

Beta LifeScience SKU/CAT #: BLA-3528P
Recombinant B. pertussis Adenylate Cyclase Protein

Recombinant B. pertussis Adenylate Cyclase Protein

Beta LifeScience SKU/CAT #: BLA-3528P
Catalog No.: BLA-3528P

Product Overview

Host Species Bordetella pertussis
Accession P0DKX7
Synonym AC-HLY ACT bifunctional hemolysin-adenylate cyclase cya Cyclolysin
Description Recombinant B. pertussis Adenylate Cyclase Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MQQSHQAGYANAADRESGIPAAVLDGIKAVAKEKNATLMFRLVNPHSTSL IAEGVATKGLGVHAKSSDWGLQAGYIPVNPNLSKLFGRAPEVIARADNDV NSSLAHGHTAVDLTLSKERLDYLRQAGLVTGMADGVVASNHAGYEQFEFR VKETSDGRYAVQYRRKGGDDFEAVKVIGNAAGIPLTADIDMFAIMPHLSN FRDSARSSVTSGDSVTDYLARTRRAASEATGGLDRERIDLLWKIARAGAR SAVGTEARRQFRYDGDMNIGVITDFELEVRNALNRRAHAVGAQDVVQHGT EQNNPFPEADEKIFVVSATGESQMLTRGQLKEYIGQQRGEGYVFYENRAY GVAGKSLFDDGLGAAPGVPSGRSKFSPDVLETVPASPGLRRPSLGAVERQ DSGYDSLDGVGSRSFSLGEVSDMAAVEAAELEMTRQVLHAGARQDDAEPG VSGASAHWGQRALQGAQAVAAAQRLVHAIALMTQFGRAGSTNTPQEAASL SAAVFGLGEASSAVAETVSGFFRGSSRWAGGFGVAGGAMALGGGIAAAVG AGMSLTDDAPAGQKAAAGAEIALQLTGGTVELASSIALALAAARGVTSGL QVAGASAGAAAGALAAALSPMEIYGLVQQSHYADQLDKLAQESSAYGYEG DALLAQLYRDKTAAEGAVAGVSAVLSTVGAAVSIAAAASVVGAPVAVVTS LLTGALNGILRGVQQPIIEKLANDYARKIDELGGPQAYFEKNLQARHEQL ANSDGLRKMLADLQAGWNASSVIGVQTTEISKSALELAAITGNADNLKSV DVFVDRFVQGERVAGQPVVLDVAAGGIDIASRKGERPALTFITPLAAPGE EQRRRTKTGKSEFTTFVEIVGKQDRWRIRDGAADTTIDLAKVVSQLVDAN GVLKHSIKLDVIGGDGDDVVLANASRIHYDGGAGTNTVSYAALGRQDSIT VSADGERFNVRKQLNNANVYREGVATQTTAYGKRTENVQYRHVELARVGQ LVEVDTLEHVQHIIGGAGNDSITGNAHDNFLAGGSGDDRLDGGAGNDTLV GGEGQNTVIGGAGDDVFLQDLGVWSNQLDGGAGVDTVKYNVHQPSEERLE RMGDTGIHADLQKGTVEKWPALNLFSVDHVKNIENLHGSRLNDRIAGDDQ DNELWGHDGNDTIRGRGGDDILRGGLGLDTLYGEDGNDIFLQDDETVSDD IDGGAGLDTVDYSAMIHPGRIVAPHEYGFGIEADLSREWVRKASALGVDY YDNVRNVENVIGTSMKDVLIGDAQANTLMGQGGDDTVRGGDGDDLLFGGD GNDMLYGDAGNDTLYGGLGDDTLEGGAGNDWFGQTQAREHDVLRGGDGVD TVDYSQTGAHAGIAAGRIGLGILADLGAGRVDKLGEAGSSAYDTVSGIEN VVGTELADRITGDAQANVLRGAGGADVLAGGEGDDVLLGGDGDDQLSGDA GRDRLYGEAGDDWFFQDAANAGNLLDGGDGRDTVDFSGPGRGLDAGAKGV FLSLGKGFASLMDEPETSNVLRNIENAVGSARDDVLIGDAGANVLNGLAG NDVLSGGAGDDVLLGDEGSDLLSGDAGNDDLFGGQGDDTYLFGVGYGHDT IYESGGGHDTIRINAGADQLWFARQGNDLEIRILGTDDALTVHDWYRDAD HRVEIIHAANQAVDQAGIEKLVEAMAQYPDPGAAAAAPPAARVPDTLMQS LAVNWR
Molecular Weight 178 kDa
Purity >80% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Addition of 10~100 ng/ml of BLA-3528P to medium significantly increased the levels of cellular cAMP levels in CHO and human monocyte cells.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed