Recombinant A. thaliana Osmotin like Protein OSM34 (His tag)

Beta LifeScience SKU/CAT #: BLA-3512P
Recombinant A. thaliana Osmotin like Protein OSM34 (His tag)

Recombinant A. thaliana Osmotin like Protein OSM34 (His tag)

Beta LifeScience SKU/CAT #: BLA-3512P
Catalog No.: BLA-3512P

Product Overview

Host Species Arabidopsis thaliana
Accession P50700
Synonym OSL3_ARATH OSM34 Osmotin-like protein OSM34
Description Recombinant A. thaliana Osmotin like Protein OSM34 (His tag) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNC NFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLV DGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQ YCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFC PRSRLGATGSHQLPIKMVTEEN
Molecular Weight 44 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed