Recombinant A. thaliana NADPH-dependent oxidoreductase 2-alkenal reductase Protein
Beta LifeScience
SKU/CAT #: BLA-7614P
Recombinant A. thaliana NADPH-dependent oxidoreductase 2-alkenal reductase Protein
Beta LifeScience
SKU/CAT #: BLA-7614P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Arabidopsis thaliana |
Accession | Q39172 |
Synonym | DBR1 NADP-dependent alkenal double bond reductase P1 P1 P1_ARATH |
Description | Recombinant A. thaliana NADPH-dependent oxidoreductase 2-alkenal reductase Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MTATNKQVILKDYVSGFPTESDFDFTTTTVELRVPEGTNSVLVKNLYLSC DPYMRIRMGKPDPSTAALAQAYTPGQPIQGYGVSRIIESGHPDYKKGDLL WGIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEV CSPKEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKF GFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGR IAVCGMISQYNLENQEGVHNLSNIIYKRIRIQGFVVSDFYDKYSKFLEFV LPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVVARE |
Molecular Weight | 38 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Involved in the detoxification of reactive carbonyls. Acts on lipid peroxide-derived reactive aldehydes. Specific to a double bond activated by an adjacent carbonyl group. Can use both quinones and diamide as substrates, but not menadione, ferricyanide or phylloquinone. Can use 4-hydroxy-(2E)-nonenal (HNE), 4-hydroxy-(2E)-hexenal (HHE), (2E)-nonenal, (2E)-hexenal, (2E)-pentenal, propenal (acrolein), 3-buten-2-one and 3-penten-2-one, but not (R)-(-)-carvone, n-nonanal, n-hexanal, (3Z)-hexanal, cyclohex-2-en-1-one or 12-oxo phytodienoic acid (OPDA) as electron acceptors. Catalyzes the reduction of the alpha,beta-unsaturated bond of 2-alkenals, of lipid peroxide-derived oxenes 9-oxo-10(E),12(Z)-octadecadienoic acid (9-KODE) and 13-oxo-9(Z),11(E)-octadecadienoic acid (13-KODE), as well as 4-oxo-(2E)-nonenal and 4-hydroxynonenal. Can use 12-oxo-10(E) dodecanoate (traumatin), trans-1,3 diphenyl-2-propenone, trans-1,4-diphenyl-2-butene-1,4-dione, 9-oxo-12,13-epoxy-(10E)-octadecenoic acid (trans-EKODE-1b) and 9,13-dihydroxy-10-oxo-11-octadecenoic acid as substrates. Catalyzes the reduction of the 7-8 double bond of phenylpropanal substrates, such as p-coumaryl aldehyde and coniferyl aldehyde (in vitro). Has activity towards toxic substrates, such as 4-hydroxy-(2E)-nonenal (in vitro). May play a distinct role in plant antioxidant defense and is possibly involved in NAD(P)/NAD(P)H homeostasis. |
Subcellular Location | Cytoplasm. Nucleus, nucleoplasm. |
Protein Families | NADP-dependent oxidoreductase L4BD family |
Database References | |
Tissue Specificity | Expressed in leaves. |
Gene Functions References
- Crystal study of Arabidopsis alkenal double bond reductase encoded by At5g16970 determines that it belongs to the zinc-independent medium chain dehydrogenase/reductase superfamily. PMID: 17028190