Recombinant 4,5-DOPA dioxygenase extradiol Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7608P
Recombinant 4,5-DOPA dioxygenase extradiol Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7608P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Portulaca grandiflora |
Accession | Q7XA48 |
Description | Recombinant 4,5-DOPA dioxygenase extradiol Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGVGKEVSFKESFFLSHGNPAMLADESFIARNFLLGWKKNVFPVKPKSIL VVSAHWETDVPCVSAGQYPNVIYDFTEVPASMFQMKYPAPGCPKLAKRVQ ELLIAGGFKSAKLDEERGFDHSSWVPLSMMCPEADIPVCQLSVQPGLDAT HHFNVGRALAPLKGEGVLFIGSGGAVHPSDDTPHWFDGVAPWAAEFDQWL EDALLEGRYEDVNNYQTKAPEGWKLAHPIPEHFLPLHVAMGAGGEKSKAE LIYRTWDHGTLGYASYKFTSI |
Molecular Weight | 50 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Opens the cyclic ring of dihydroxy-phenylalanine (DOPA) between carbons 4 and 5, thus producing an unstable seco-DOPA that rearranges nonenzymatically to betalamic acid. |
Subcellular Location | Cytoplasm. |
Protein Families | DODA-type extradiol aromatic ring-opening dioxygenase family |
Tissue Specificity | Expressed only in colored petals and pigmented tissues, absent from green stems and leaves. |