Native Cow 20S Immunoproteasome Protein
Beta LifeScience
SKU/CAT #: BLA-11851P
Native Cow 20S Immunoproteasome Protein
Beta LifeScience
SKU/CAT #: BLA-11851P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cow |
Accession | Q3ZBG0 |
Synonym | Proteasome subunit alpha type-7 Proteasome subunit RC6-1 Proteasome subunit XAPC7 PSA7_HUMAN PSMA7 |
Description | Native Cow 20S Immunoproteasome Protein is native.. It is a Full length protein |
Source | Native |
AA Sequence | MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSV AKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVED PVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPS GTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQ SGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS |
Molecular Weight | 700 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |