Recombinant Zebrafish IL1 beta Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1075P
Recombinant Zebrafish IL1 beta Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1075P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Zebrafish |
Accession | E6N152 |
Synonym | Catabolin H1 IFN beta inducing factor IL 1 IL 1 beta IL-1 beta IL1 IL1 BETA IL1B IL1B_HUMAN IL1F2 Interleukin 1 beta Interleukin 1 beta precursor interleukin 1, beta Interleukin-1 beta OAF Osteoclast activating factor OTTHUMP00000162031 Preinterleukin 1 beta Preinterleukin beta Pro interleukin 1 beta |
Description | Recombinant Zebrafish IL1 beta Protein (His tag) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | CDMHEGIRLEMWTSQHKMKQLVNVIIALNRMKHIKPQSTEFGEKEVLDML MANVIQEREVNVVDSVPSYTKTKNVLQCTICDQYKKSLVRSGGSPHLQAV TLRAGSSDLKVRFSMSTYASPSAPATSAQPVCLGISKSNLYLACSPAEGS APHLVLKEISGSLETIKAGDPNGYDQLLFFRKETGSSINTFESVKCPGWF ISTAYEDSQMVEMDRKDTERIINFELQDKVRI |
Molecular Weight | 30 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |