Recombinant Mouse MDC Protein

Collections: Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	O88430
Synonym	A 152E5.1 ABCD 1 ABCD1 C C motif chemokine 22 CC chemokine STCP 1 CC chemokine STCP-1 ccl 22 Ccl22 CCL22_HUMAN Chemokine (C C motif) ligand 22 DC/B CK DCBCK Macrophage-derived chemokine MDC MDC(1-69) MDC(7-69) MGC34554 SCYA22 Small inducible cytokine subfamily A (Cys Cys) member 22 Small inducible cytokine subfamily A, member 22 Small-inducible cytokine A22 STCP 1 STCP1 Stimulated T cell chemotactic protein 1 Stimulated T-cell chemotactic protein 1
Description	Recombinant Mouse MDC Protein was expressed in Freestyle 293-F cells. It is a Full length protein
Source	Freestyle 293-F cells
AA Sequence	GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRD ICADPRQVWVKKLLHKLS
Molecular Weight	8 kDa
Purity	>97% SDS-PAGE.>97% as determined by HPLC.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human activated lymphocytes is in a concentration range of 10-100 ng/ml.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Chemotactic for activated T-lymphocytes. May play an important role in the collaboration of dendritic cells and B-lymphocytes with T-cells in immune responses.
Subcellular Location	Secreted.
Protein Families	Intercrine beta (chemokine CC) family
Database References	KEGG: mmu:20299 STRING: 10090.ENSMUSP00000034231 UniGene: Mm.12895
Tissue Specificity	Expressed by activated splenic B-lymphocytes and dendritic cells. Low expression in lung, thymocytes, lymph node, and unstimulated splenic cells.

Gene Functions References

the subset of peritoneal CD11b(+)CD169(+) macrophages increased and CCL22 expression level decreased significantly during the DSS-induced colitis PMID: 28466432
Intratumoral administration of anti-CCL22 antibody inhibited B16F10 melanoma growth. PMID: 28668835
this study shows that intravenous injection of apoptotic cells induces a subsequent increase in CCL22 expression and CCR4+ Treg cells, which contribute to the maintenance of immune homeostasis at least partially by splenic CD8alpha+ CD103+ dendritic cells PMID: 26868141
CCL22-specific antibodies reveal that engagement of two distinct binding domains on CCL22 is required for CCR4-mediated function. PMID: 26683175
CCL22 was localised mainly on the cell surface and or in the cytoplasm. Within sections of omental milky spot micrometastases, CCR4 was recognised on or in gastric cancer cells, constituent cells milky spots, blood cells and blood endothelial cells PMID: 25245466
results show that the IL-4/CCL22/CCR4 axis is involved in the migration of Tregs to osteolytic lesion sites, and attenuates development of lesions by inhibiting inflammatory migration and the production of proinflammatory and osteoclastogenic mediators PMID: 25264308
CCL22 has a role in Treg skin homing to suppress depigmentation PMID: 25634358
CCL22 is a novel mediator of lung inflammation following hemorrhage and resuscitation PMID: 25136780
The immunomodulatory properties of CCL22 could be harnessed for prevention of graft rejection and type 1 diabetes as well as other autoimmune disorders. PMID: 25740943
Data indicate macrophage-derived chemokine CCL22 as an adjuvant could enhance the immune protective effect of NTHi-P6 protein vaccine to an extent. PMID: 25200152
islet expression of CCL22 recruits Tregs and attenuates autoimmune destruction of beta cell PMID: 21737880
Data show that the presence of the Ccr4 and Ccl22 transcripts were detected in brain slices. PMID: 21177120
These results suggest that CCL22 functions to regulate development of experimental autoimmune encephalomyelitis through macrophage chemoattraction and effector function. PMID: 20940325
role of CCL22 for the recruitment of eosinophils during allergic pleurisy PMID: 12629149
functionally increased expression during Salmonella enterica serovar Typhimurium infection of dendritic cells PMID: 15731072
Regulatory elements of the CCL22 gene required to mediate a strong and highly specific expression are included in a 4.1-kb promoter region, with the major elements active in dendritic cells and B cells being located in a small proximal 250-bp region. PMID: 15843561
CCL22 was selectively upregulated in osteoclast-like cells derived from RAW264.7 cells and mouse bone marrow cells upon stimulation with RANKL (receptor activator of nuclear factor-kappaB ligand). PMID: 16821125
IgE appears to be capable of stimulating basophils to produce MDC in the absence of a specific Ag, which may contribute to IgE-mediated and/or Th2-predominant allergic inflammation. PMID: 18832724
When isolated, only natural killer (NK)-containing cellular fractions secrete CCL22, and the same fraction isolated from metastatic Lewis lung carcinoma (LLC)-bearing lungs secrete higher levels. PMID: 19234170
Mice genetically deficient in CCR4 (the receptor for CCL22) show markedly reduced indoleamine dioxygenase (IDO) expression in MLN-DCs and support the involvement of the CCL22/CCR4 axis in IDO induction. PMID: 19843945

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.