Recombinant Mouse IL3 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0600P
Recombinant Mouse IL3 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0600P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P01586 |
Synonym | Colony stimulating factor multiple Hematopoietic growth factor IL 3 IL-3 IL3 IL3_HUMAN Interleukin 3 Interleukin 3 (colony stimulating factor, multiple) Interleukin-3 Mast cell growth factor MCGF MGC79398 MGC79399 Multi CSF Multilineage colony stimulating factor Multipotential colony stimulating factor Multipotential colony-stimulating factor OTTHUMP00000065963 P cell stimulating factor P-cell-stimulating factor |
Description | Recombinant Mouse IL3 Protein (His tag) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRV NLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDD FRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVECHHHHHH |
Molecular Weight | 16 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. |
Target Details
Target Function | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. |
Subcellular Location | Secreted. |
Protein Families | IL-3 family |
Database References | |
Tissue Specificity | Activated T-cells, mast cells, natural killer cells. |
Gene Functions References
- Jak1-deficient hematopoietic stem cells exhibit increased quiescence, an inability to enter the cell cycle in response to hematopoietic stress, and a marked reduction in cytokine sensing, including in response to type I interferons and IL-3. PMID: 28965767
- findings indicate that STAT5 contributes to the remarkable IL-3-mediated inhibition of RANKL-induced osteoclastogenesis by activating Id genes and their associated pathways. PMID: 27485735
- c-Kit(+) Adipose tissue-derived mesenchymal stem cells (ASCs)may promote breast cancer growth and angiogenesis by a synergistic effect of c-Kit and IL-3. Our findings suggest that c-Kit(+) subpopulations of ASCs should be eliminated in fat grafts for breast reconstruction of cancer patients following mastectomy. PMID: 28573141
- These impaired macrophage functions in leukemic mice were significantly corrected by IL-3 and GM-CSF treatment indicating the therapeutic benefit of these two cytokines in leukemia. PMID: 28039843
- IL-3 signaling does not contribute to Jak2 V617F myeloproliferative neoplasm pathogenesis. PMID: 26589916
- Thus, IL-3 plays an important role in the pathogenesis of SLE and the progression of lupus nephritis. PMID: 26131743
- Cytoplasmic granule containing HERMES, NonO, PSF, and G3BP1 is a neuronal RNA-protein granule that is transported in neurites during retinal differentiation. PMID: 25651939
- Stem cell factor (SCF), but not interleukin-3 (IL-3), is a major effector of HSC maturation during embryonic day E9-E10. PMID: 25241746
- study reports IL3 potentiates inflammation in sepsis; in model of abdominal sepsis, findings show innate response activator B cells produce IL3, which induces myelopoiesis of monocytes and neutrophils and fuels cytokine storm; IL3 deficiency protects against sepsis PMID: 25766237
- Altered expression of CD30L and IL-3 may be potential biomarkers for hepatotoxicity induced by D. bulbifera. PMID: 24647110
- This study is the first to link beta-catenin activation to IL-3 and suggests that targeting IL-3 signaling may be an effective approach for the inhibition of beta-catenin activity in some patients with AML. PMID: 24598054
- IL-3 plays a critical role in suppressing protective immunity to P. berghei NK65 infection. PMID: 24379292
- IL-3 promotes Stat5 activation in osteoclasts. PMID: 24367002
- these findings not only provide a better understanding of the role of IL-3 in osteoclastogenesis but may also facilitate future studies to delineate the role of IL-3 in the pathogenesis of bone diseases. PMID: 24103757
- At day 10, CIP treatment not only significantly reduced pro-inflammatory cytokine and chemokine concentrations, including interleukin-6 (IL-6) and KC, but it also enhanced IL-3 production compared to vehicle-treated controls. PMID: 23520506
- IL-3 upregulates Trib3 mRNA expression in bone-marrow-derived mast cells. During prolonged IL-3 starvation, cell death is accelerated in Trib3-null cultures. PMID: 23261831
- confirm for the first time that IL-3 and IL-4 are critical for IL-33 intracrine in murine cells of various types, indicating that IL-3 and IL-4 may play an important role in the constitutive expression of IL-33 in vivo PMID: 22370606
- p53(-/-) cells have a deregulated intracellular signaling environment and display a more rapid and sustained response to IL-3. This was accompanied by an increase in active ERK1/2 and a dependence on an intact MAP kinase signaling pathway PMID: 22348085
- Mast cells cultured from IL-3-treated mice show impaired responses to bacterial antigen stimulation PMID: 22068549
- these findings suggest CNSa is a distal enhancer of the IL-3/GM-CSF gene cluster that binds BRG1 and NF-kappaB PMID: 21831442
- IL-3 markedly amplifies primitive erythroid and macrophage precursors in E7.5 embryos and has a regulatory role with regard to both number and capacity of the dual-potential hemangioblast. PMID: 20007140
- Inhibition of IL-3 signaling and knockdown of Xbp1-induced apoptosis in hematopoietic cells. PMID: 21368889
- Data indicate a role for PLCgamma2 and Ca(2+) signaling through the modulation of MEK/ERK in IL3/GM-csf stimulated mouse hematopoietic stem/progenitor cells. PMID: 21506110
- structural studies of soluble, recombinant IL3 fragment (33-156): four-helical bundle fold; conformation typical of short-chain cytokines; core of highly conserved hydrophobic residues; pronounced conformational heterogeneity PMID: 21329364
- Complex interactions in EML cell stimulation by stem cell factor and IL-3. PMID: 21383156
- Recombinant murine IL-3 plays an important role in modulating regulatory T (Treg) cell development in both in vitro and in vivo conditions and significantly reduces the severity of collagen-induced arthritis. PMID: 21242512
- Studies indicate that BMP and IL-3 signaling pathways are critical for the growth and potential of embryonic HSCs. PMID: 20711995
- SHP-1 positively regulates IL-3-dependent mast cell proliferation and apoptosis by inhibiting ERK activity through its phosphatase activity. PMID: 21044800
- IL-3 irreversibly inhibits RANK expression that results in inhibition of important signaling molecules induced by RANKL during osteoclastogenesis. PMID: 20691668
- the domain 1 D-E loop disulfide of hbetac and beta(IL-3) in maintaining the precise positions of ligand-binding residues necessary for normal high affinity binding and signaling PMID: 20516062
- Two different modes of beta c binding are utilized in the presence of the hIL-3R alpha isoforms. PMID: 20472554
- The IL-3/IL-3 receptor system is absolutely required to recruit circulating basophils into the draining lymph nodes following helminth infection. PMID: 20038645
- IL-3 and oncogenic Abl regulate the myeloblast transcriptome by altering mRNA stability PMID: 19829692
- p53 protein is activated after IL-3 deprivation by loss of MDM2. Activated p53 transcriptionally up-regulates Puma, which initiates apoptosis. PMID: 19965665
- Role of pRB-family/E2F complex in the inhibition of IL-3-dependent lymphoid cell proliferation. PMID: 11886176
- relevance to peripheral myeloid recruitment PMID: 12115609
- IL-3-driven survival and proliferation is negatively regulated, potentially via tyrosine phosphorylation of Aic2A and STAT5 PMID: 12220225
- IL3 is required for mitochondrial respiratory control PMID: 12228733
- evidence that IL-3 production is a rapid, sustained, and biologically relevant consequence of BCR-ABL expression in primitive hematopoietic cells with multilineage leukemogenic activity PMID: 12393460
- IL-3 induces activation of the PI-3 kinase, MAP kinase, & Jak/Stat pathways. Jak2 activation is the critical "proximal" mediator of the IL-3-induced enhancement of RAR activity. PMID: 12393611
- IL-3 inhibits osteoclastogenesis in whole bone marrow cells by directly acting on osteoclast precursors, irreversibly blocking receptor activator of NF-kappaB ligand (RANKL)-induced osteoclast differentiation by diverting the cells to macrophage lineage. PMID: 12816992
- The time courses for activation of phosphatidylinositol 3-kinase and its downstream target, protein kinase B, by IL-3 were consistent with a role in IL-3-induced transporter translocation and enhanced glucose uptake. PMID: 12869574
- Interleukin-3 and flt3 ligand induce expression of antiapoptotic Bcl-2 family genes. PMID: 12960281
- Interleukin-3 binding to the murine betaIL-3 receptor involves functional epitopes formed by domains 1 and 4 of different protein chains PMID: 15060062
- IL-3 plays a crucial role for IgE(-Ag)-induced mast cell survival, functioning in an autocrine manner by inducing the Bcl-xL/Bcl-2 via signal transducer and activator of transduction 5 PMID: 15542585
- IL-3 induces inhibitor of DNA-binding protein 1 (Id1) expression in multipotential erythroid-myeloid-lymphoid cells during myeloid, but not B cell or erythroid cell differentiation. PMID: 15905544
- Results describe the effects of a leukemia-associated gain-of-function mutation of SHP-2 phosphatase on interleukin-3 signaling. PMID: 16371368
- The importance of IL-3-induced TNF secretion was demonstrated by the failure of TNF-deficient bone marrow cells to survive for >3 wk when cultured in IL-3 and SCF, a defect that was reversed by the addition of soluble TNF PMID: 16455967
- Inhibition of the PI3 kinase pathway promoted apoptosis in the presence or absence of IL-3. PMID: 16705087
- in mice with markedly impaired SCF/c-Kit signaling, IL-3 contributed significantly to the increased numbers of eosinophils that were observed during Strongyloides venezuelensis infection, but not during infection with Nippostrongylus brasiliensis PMID: 16894356