Recombinant Mouse IL3 Protein (His tag)

Collections: Cytokines and growth factors, Interleukins and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	P01586
Synonym	Colony stimulating factor multiple Hematopoietic growth factor IL 3 IL-3 IL3 IL3_HUMAN Interleukin 3 Interleukin 3 (colony stimulating factor, multiple) Interleukin-3 Mast cell growth factor MCGF MGC79398 MGC79399 Multi CSF Multilineage colony stimulating factor Multipotential colony stimulating factor Multipotential colony-stimulating factor OTTHUMP00000065963 P cell stimulating factor P-cell-stimulating factor
Description	Recombinant Mouse IL3 Protein (His tag) was expressed in Mammalian. It is a Full length protein
Source	Mammalian
AA Sequence	ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRV NLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDD FRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVECHHHHHH
Molecular Weight	16 kDa including tags
Purity	>95% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C.

Target Details

Target Function	Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
Subcellular Location	Secreted.
Protein Families	IL-3 family
Database References	KEGG: mmu:16187 STRING: 10090.ENSMUSP00000019058 UniGene: Mm.983
Tissue Specificity	Activated T-cells, mast cells, natural killer cells.

Gene Functions References

Jak1-deficient hematopoietic stem cells exhibit increased quiescence, an inability to enter the cell cycle in response to hematopoietic stress, and a marked reduction in cytokine sensing, including in response to type I interferons and IL-3. PMID: 28965767
findings indicate that STAT5 contributes to the remarkable IL-3-mediated inhibition of RANKL-induced osteoclastogenesis by activating Id genes and their associated pathways. PMID: 27485735
c-Kit(+) Adipose tissue-derived mesenchymal stem cells (ASCs)may promote breast cancer growth and angiogenesis by a synergistic effect of c-Kit and IL-3. Our findings suggest that c-Kit(+) subpopulations of ASCs should be eliminated in fat grafts for breast reconstruction of cancer patients following mastectomy. PMID: 28573141
These impaired macrophage functions in leukemic mice were significantly corrected by IL-3 and GM-CSF treatment indicating the therapeutic benefit of these two cytokines in leukemia. PMID: 28039843
IL-3 signaling does not contribute to Jak2 V617F myeloproliferative neoplasm pathogenesis. PMID: 26589916
Thus, IL-3 plays an important role in the pathogenesis of SLE and the progression of lupus nephritis. PMID: 26131743
Cytoplasmic granule containing HERMES, NonO, PSF, and G3BP1 is a neuronal RNA-protein granule that is transported in neurites during retinal differentiation. PMID: 25651939
Stem cell factor (SCF), but not interleukin-3 (IL-3), is a major effector of HSC maturation during embryonic day E9-E10. PMID: 25241746
study reports IL3 potentiates inflammation in sepsis; in model of abdominal sepsis, findings show innate response activator B cells produce IL3, which induces myelopoiesis of monocytes and neutrophils and fuels cytokine storm; IL3 deficiency protects against sepsis PMID: 25766237
Altered expression of CD30L and IL-3 may be potential biomarkers for hepatotoxicity induced by D. bulbifera. PMID: 24647110
This study is the first to link beta-catenin activation to IL-3 and suggests that targeting IL-3 signaling may be an effective approach for the inhibition of beta-catenin activity in some patients with AML. PMID: 24598054
IL-3 plays a critical role in suppressing protective immunity to P. berghei NK65 infection. PMID: 24379292
IL-3 promotes Stat5 activation in osteoclasts. PMID: 24367002
these findings not only provide a better understanding of the role of IL-3 in osteoclastogenesis but may also facilitate future studies to delineate the role of IL-3 in the pathogenesis of bone diseases. PMID: 24103757
At day 10, CIP treatment not only significantly reduced pro-inflammatory cytokine and chemokine concentrations, including interleukin-6 (IL-6) and KC, but it also enhanced IL-3 production compared to vehicle-treated controls. PMID: 23520506
IL-3 upregulates Trib3 mRNA expression in bone-marrow-derived mast cells. During prolonged IL-3 starvation, cell death is accelerated in Trib3-null cultures. PMID: 23261831
confirm for the first time that IL-3 and IL-4 are critical for IL-33 intracrine in murine cells of various types, indicating that IL-3 and IL-4 may play an important role in the constitutive expression of IL-33 in vivo PMID: 22370606
p53(-/-) cells have a deregulated intracellular signaling environment and display a more rapid and sustained response to IL-3. This was accompanied by an increase in active ERK1/2 and a dependence on an intact MAP kinase signaling pathway PMID: 22348085
Mast cells cultured from IL-3-treated mice show impaired responses to bacterial antigen stimulation PMID: 22068549
these findings suggest CNSa is a distal enhancer of the IL-3/GM-CSF gene cluster that binds BRG1 and NF-kappaB PMID: 21831442
IL-3 markedly amplifies primitive erythroid and macrophage precursors in E7.5 embryos and has a regulatory role with regard to both number and capacity of the dual-potential hemangioblast. PMID: 20007140
Inhibition of IL-3 signaling and knockdown of Xbp1-induced apoptosis in hematopoietic cells. PMID: 21368889
Data indicate a role for PLCgamma2 and Ca(2+) signaling through the modulation of MEK/ERK in IL3/GM-csf stimulated mouse hematopoietic stem/progenitor cells. PMID: 21506110
structural studies of soluble, recombinant IL3 fragment (33-156): four-helical bundle fold; conformation typical of short-chain cytokines; core of highly conserved hydrophobic residues; pronounced conformational heterogeneity PMID: 21329364
Complex interactions in EML cell stimulation by stem cell factor and IL-3. PMID: 21383156
Recombinant murine IL-3 plays an important role in modulating regulatory T (Treg) cell development in both in vitro and in vivo conditions and significantly reduces the severity of collagen-induced arthritis. PMID: 21242512
Studies indicate that BMP and IL-3 signaling pathways are critical for the growth and potential of embryonic HSCs. PMID: 20711995
SHP-1 positively regulates IL-3-dependent mast cell proliferation and apoptosis by inhibiting ERK activity through its phosphatase activity. PMID: 21044800
IL-3 irreversibly inhibits RANK expression that results in inhibition of important signaling molecules induced by RANKL during osteoclastogenesis. PMID: 20691668
the domain 1 D-E loop disulfide of hbetac and beta(IL-3) in maintaining the precise positions of ligand-binding residues necessary for normal high affinity binding and signaling PMID: 20516062
Two different modes of beta c binding are utilized in the presence of the hIL-3R alpha isoforms. PMID: 20472554
The IL-3/IL-3 receptor system is absolutely required to recruit circulating basophils into the draining lymph nodes following helminth infection. PMID: 20038645
IL-3 and oncogenic Abl regulate the myeloblast transcriptome by altering mRNA stability PMID: 19829692
p53 protein is activated after IL-3 deprivation by loss of MDM2. Activated p53 transcriptionally up-regulates Puma, which initiates apoptosis. PMID: 19965665
Role of pRB-family/E2F complex in the inhibition of IL-3-dependent lymphoid cell proliferation. PMID: 11886176
relevance to peripheral myeloid recruitment PMID: 12115609
IL-3-driven survival and proliferation is negatively regulated, potentially via tyrosine phosphorylation of Aic2A and STAT5 PMID: 12220225
IL3 is required for mitochondrial respiratory control PMID: 12228733
evidence that IL-3 production is a rapid, sustained, and biologically relevant consequence of BCR-ABL expression in primitive hematopoietic cells with multilineage leukemogenic activity PMID: 12393460
IL-3 induces activation of the PI-3 kinase, MAP kinase, & Jak/Stat pathways. Jak2 activation is the critical "proximal" mediator of the IL-3-induced enhancement of RAR activity. PMID: 12393611
IL-3 inhibits osteoclastogenesis in whole bone marrow cells by directly acting on osteoclast precursors, irreversibly blocking receptor activator of NF-kappaB ligand (RANKL)-induced osteoclast differentiation by diverting the cells to macrophage lineage. PMID: 12816992
The time courses for activation of phosphatidylinositol 3-kinase and its downstream target, protein kinase B, by IL-3 were consistent with a role in IL-3-induced transporter translocation and enhanced glucose uptake. PMID: 12869574
Interleukin-3 and flt3 ligand induce expression of antiapoptotic Bcl-2 family genes. PMID: 12960281
Interleukin-3 binding to the murine betaIL-3 receptor involves functional epitopes formed by domains 1 and 4 of different protein chains PMID: 15060062
IL-3 plays a crucial role for IgE(-Ag)-induced mast cell survival, functioning in an autocrine manner by inducing the Bcl-xL/Bcl-2 via signal transducer and activator of transduction 5 PMID: 15542585
IL-3 induces inhibitor of DNA-binding protein 1 (Id1) expression in multipotential erythroid-myeloid-lymphoid cells during myeloid, but not B cell or erythroid cell differentiation. PMID: 15905544
Results describe the effects of a leukemia-associated gain-of-function mutation of SHP-2 phosphatase on interleukin-3 signaling. PMID: 16371368
The importance of IL-3-induced TNF secretion was demonstrated by the failure of TNF-deficient bone marrow cells to survive for >3 wk when cultured in IL-3 and SCF, a defect that was reversed by the addition of soluble TNF PMID: 16455967
Inhibition of the PI3 kinase pathway promoted apoptosis in the presence or absence of IL-3. PMID: 16705087
in mice with markedly impaired SCF/c-Kit signaling, IL-3 contributed significantly to the increased numbers of eosinophils that were observed during Strongyloides venezuelensis infection, but not during infection with Nippostrongylus brasiliensis PMID: 16894356

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.