Recombinant Zebrafish Erythropoietin (EPO) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06162P
Greater than 90% as determined by SDS-PAGE.
Recombinant Zebrafish Erythropoietin (EPO) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06162P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Zebrafish Erythropoietin (EPO) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q2XNF5 |
Target Symbol | EPO |
Synonyms | epo; Erythropoietin; Erythropoietin-L2 |
Species | Danio rerio (Zebrafish) (Brachydanio rerio) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | SPLRPICDLRVLDHFIKEAWDAEAAMRTCKDDCSIATNVTVPLTRVDFEVWEAMNIEEQAQEVQSGLHMLNEAIGSLQISNQTEVLQSHIDASIRNIASIRQVLRSLSIPEYVPPTSSGEDKETQKISSISELFQVHVNFLRGKARLLLANAPVCRQGVS |
Expression Range | 24-183aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 19.8 |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. |
Subcellular Location | Secreted. |
Protein Families | EPO/TPO family |
Database References | |
Tissue Specificity | Expressed in heart and liver. |
Gene Functions References
- The zebrafish epo cDNA was cloned and the expression of zepo mRNA was mainly in the heart and liver. PMID: 17706649
- characterization of zebrafish epo and epor demonstrates the conservation of an ancient program that ensures proper red blood cell numbers during normal homeostasis and under hypoxic conditions PMID: 17579187