Recombinant Yersinia Pestis Coagulase/Fibrinolysin (PLA) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04938P
Greater than 85% as determined by SDS-PAGE.
Recombinant Yersinia Pestis Coagulase/Fibrinolysin (PLA) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04938P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Yersinia Pestis Coagulase/Fibrinolysin (PLA) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P17811 |
| Target Symbol | PLA |
| Synonyms | pla; YPPCP1.07; YP_pPCP08Coagulase/fibrinolysin; EC 3.4.23.48; Plasminogen activator |
| Species | Yersinia pestis |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | ASSQLIPNISPDSFTVAASTGMLSGKSHEMLYDAETGRKISQLDWKIKNVAILKGDISWDPYSFLTLNARGWTSLASGSGNMDDYDWMNENQSEWTDHSSHPATNVNHANEYDLNVKGWLLQDENYKAGITAGYQETRFSWTATGGSYSYNNGAYTGNFPKGVRVIGYNQRFSMPYIGLAGQYRINDFELNALFKFSDWVRAHDNDEHYMRDLTFREKTSGSRYYGTVINAGYYVTPNAKVFAEFTYSKYDEGKGGTQTIDKNSGDSVSIGGDAAGISNKNYTVTAGLQYRF |
| Expression Range | 21-312aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 40.1 kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Seems to play an essential role in plague transmission by mediating flea blockage in a temperature-dependent fashion. Fibrinolytic activity prevails at 37 degrees Celsius whereas coagulase expression predominates at lower temperatures (<30 degrees Celsius). Activates plasminogen by cleaving it. |
| Subcellular Location | Cell outer membrane; Multi-pass membrane protein. |
| Protein Families | Peptidase A26 family |
| Database References | KEGG: ype:YPPCP1.07 |
Gene Functions References
- PAI-1 is an in vivo target of the Pla protease in the lungs, and PAI-1 is a key regulator of the pulmonary innate immune response PMID: 27377187
- YapE uses proteolysis by omptin Pla ( plasminogen activator protease) to activate adhesive properties. PMID: 23701256
- findings show Pla is essential for Y. pestis to cause primary pneumonic plague but is less important for dissemination during pneumonic plague than bubonic plague; Pla allows Y. pestis to replicate rapidly in airways, causing lethal fulminant pneumonia PMID: 17255510
- These data indicated that a significant attenuation in bacterial virulence occurred in a mouse model of pneumonic plague when both the lpp gene and the virulence plasmid pPCP1 encoding the pla gene were deleted from Yersinia pestis. PMID: 19589835
