Recombinant Xenopus Laevis Decapping And Exoribonuclease Protein (DXO) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00117P
Greater than 85% as determined by SDS-PAGE.
Recombinant Xenopus Laevis Decapping And Exoribonuclease Protein (DXO) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00117P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Xenopus Laevis Decapping And Exoribonuclease Protein (DXO) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Activity | Not tested. |
| Uniprotkb | Q5HZT0 |
| Target Symbol | DXO |
| Synonyms | (DXO)(5'-3' exoribonuclease DXO)(Dom-3 homolog Z)(NAD-capped RNA hydrolase DXO)(DeNADding enzyme DXO) |
| Species | Xenopus laevis (African clawed frog) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | MEGNKSMQREKIDRPMKRGPEQNSLSPPLAKCPFMSCSSLKTLHSLYQGSFPFYRLPSEVGHFSLDENRQYHQDNRKLRYYSPPVGIREKGSPGWNVMDGYESHYVRRNEDEKEGLLHILTWLEKNRGVLGAHVEGGSKRPIDRDFVTWRGHLTKILCTPYETQEGWLLAVTLFKGTFYISEQETEAAQKKRKERSLEQERLMYSGYKFESYICADSPDRQPSQSAVVNTNEGFCSVLLARLTSHSLLISGEVDCTDPSAKKSIPPTCYIELKSSAQIRNPHQQRSFNRYKLLKWWCQSFLLGIPIIVAGFRSPEGRIVSLETFKTSDIPHLVRGERNSWDPAVCMNFCNKFLSHIKSVVTRDDPRLVYLFAWEPGCDVTFTVHTDPEYTILPSWYVNSVN |
| Expression Range | 1-401aa |
| Protein Length | Full Length |
| Mol. Weight | 50.3 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Decapping enzyme for NAD-capped RNAs: specifically hydrolyzes the nicotinamide adenine dinucleotide (NAD) cap from a subset of RNAs by removing the entire NAD moiety from the 5'-end of an NAD-capped RNA. The NAD-cap is present at the 5'-end of some RNAs and snoRNAs. In contrast to the canonical 5'-end N7 methylguanosine (m7G) cap, the NAD cap promotes mRNA decay. Also acts as a non-canonical decapping enzyme that removes the entire cap structure of m7G capped or incompletely capped RNAs and mediates their subsequent degradation. Specifically degrades pre-mRNAs with a defective 5'-end m7G cap and is part of a pre-mRNA capping quality control. Has decapping activity toward incomplete 5'-end m7G cap mRNAs such as unmethylated 5'-end-capped RNA (cap0), while it has no activity toward 2'-O-ribose methylated m7G cap (cap1). Also has 5'-3' exoribonuclease activities: The 5'-end monophosphate RNA is then degraded by the 5'-3' exoribonuclease activity, enabling this enzyme to decap and degrade incompletely capped mRNAs. Also possesses RNA 5'-pyrophosphohydrolase activity by hydrolyzing the 5'-end triphosphate to release pyrophosphates. Exhibits decapping activity towards FAD-capped RNAs. Exhibits decapping activity towards dpCoA-capped RNAs in vitro. |
| Subcellular Location | Nucleus. |
| Protein Families | DXO/Dom3Z family |
| Database References | KEGG: xla:496313 UniGene: Xl.3904 |
