Recombinant Vibrio Parahaemolyticus Serotype O3:K6 Thermostable Direct Hemolysin 1 (TDH1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00690P
Greater than 90% as determined by SDS-PAGE.
Recombinant Vibrio Parahaemolyticus Serotype O3:K6 Thermostable Direct Hemolysin 1 (TDH1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00690P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Vibrio Parahaemolyticus Serotype O3:K6 Thermostable Direct Hemolysin 1 (TDH1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P19249 |
| Target Symbol | TDH1 |
| Synonyms | (Kanagawa phenomenon-associated hemolysin) |
| Species | Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | FELPSVPFPAPGSDEILFVVRDTTFNTQAPVNVKVSDFWTNRNVKRKPYEDVYGQSVFTTSGTKWLTSYMTVNINDKDYTMAAVSGYKSGHSAVFVKSGQVQLQHSYNSVANFVGEDEGSIPSKMYLDETPEYFVNVEAYESGSGNILVMCISNKESFFECKHQQ |
| Expression Range | 25-189aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 26.0 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Bacterial hemolysins are exotoxins that attack blood cell membranes and cause cell rupture by mechanisms not clearly defined. |
| Protein Families | TDH hemolysin family |
| Database References | KEGG: vpa:VPA1378 STRING: 223926.VPA1378 |
