Recombinant Vibrio Cholerae Serotype O1 Cholera Enterotoxin Subunit B (CTXB) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08970P

Greater than 90% as determined by SDS-PAGE.
Recombinant Vibrio Cholerae Serotype O1 Cholera Enterotoxin Subunit B (CTXB) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08970P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Vibrio Cholerae Serotype O1 Cholera Enterotoxin Subunit B (CTXB) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P01556 |
Target Symbol | CTXB |
Synonyms | ctxB; toxB; VC_1456Cholera enterotoxin subunit B; Cholera enterotoxin B chain; Cholera enterotoxin gamma chain; Choleragenoid |
Species | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN |
Expression Range | 22-124aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 15.6kDa |
Research Area | Microbiology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | The B subunit pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself. |
Subcellular Location | Secreted. Host cell membrane. |
Database References | KEGG: vch:VC1456 STRING: 243277.VC1456 |