Recombinant Vesicular Stomatitis Indiana Virus Matrix Protein (M) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01885P
Greater than 85% as determined by SDS-PAGE.
Recombinant Vesicular Stomatitis Indiana Virus Matrix Protein (M) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01885P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Vesicular Stomatitis Indiana Virus Matrix Protein (M) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P03519 |
| Target Symbol | M |
| Species | Vesicular stomatitis Indiana virus (strain San Juan) (VSIV) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTYDPNQLRYEKFFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHTHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWVLDSISHFK |
| Expression Range | 1-229aa |
| Protein Length | Full Length |
| Mol. Weight | 33.5 kDa |
| Research Area | Tags & Cell Markers |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays a major role in assembly and budding of virion, by recruiting cellular partners of the ESCRT complexes that play a key role in releasing the budding particle from the host membrane. Condensates the ribonucleocapsid core during virus assembly.; Inhibits mRNA nuclear export through direct interaction with host RAE1-NUP98 complex, thereby preventing interferon signaling and establishment of antiviral state in infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell. Inhibits host transcription, possibly through interaction with host DNA repair factor IIH/TFIIH GTF2H5 subunit. |
| Subcellular Location | Virion membrane; Peripheral membrane protein. Host endomembrane system; Peripheral membrane protein. Host nucleus membrane; Peripheral membrane protein. Host nucleus. Host cytoplasm. |
| Protein Families | Vesiculoviruses matrix protein family |
| Database References | KEGG: vg:1489833 |
Gene Functions References
- VEGF-D-enhanced metastasis was evidently reversed by MP. MP significantly reduced the invasion of VEGFD-SK cells, tumor volume, lymphatic metastasis rates and lymphatic vessel density compared with control groups PMID: 27211072
- vesicular stomatitis virus M protein interacted efficiently with Rae1-Nup98 complexes associated with the chromatin fraction of host nuclei, consistent with an effect on host transcription PMID: 23028327
- These findings indicate that the PSAP motif plays a direct role in regulating cytopathogenicity in a species-dependent manner, and suggest that the intact PSAP motif may be important for maintaining virus persistence in an insect host. PMID: 23170175
- study re-examined the contribution of the PSAP motif to VSV budding; VSV M binds TSG101 [tumour susceptibility gene 101] through its PSAP motif; double mutant with point mutations in both PSAP and PPPY motifs is impaired compared with a single mutant in the PPPY motif, indicating the PSAP motif partially compensates for lack of the PPPY motif PMID: 22190013
- VSV M protein inactivates the cellular Akt signaling pathway. PMID: 20980511
- These findings indicate that the host shut-off activity of the M protein dominates vesicular stomatitis virus cytotoxicty, whilst the fusion-active G protein is mainly responsible for the cytotoxicity remaining with M-mutant vesicular stomatitis virus. PMID: 20631091
- hyperphosphorylation of VSV M protein was observed in both cell lysates and viral particles from IFN-beta-treated neuronal cells. Hyperphosphorylated VSV M protein was found to inhibit its association with VSV nucleocapsid PMID: 19951173
- VSV expressing the mutant M protein induces apoptosis via the death receptor apoptotic pathway, a mechanism distinct from that induced by VSV expressing the wt M protein. PMID: 15767418
- first evidence that M protein alone is able to impose the correct budding curvature on the membrane PMID: 16298982
- Glycoprotein (G protein) and M protein microdomains were not colocalized in the plasma membrane outside the virus budding sites PMID: 18367537
- M protein mutants of VSV are less virulent than wild type and can induce an antibody response similar to that in mice infected with the wt virus. PMID: 18614644
- The authors propose that low-pH conformational changes in G protein promote acidification of the virus interior, which facilitates the release of M from ribonucleoprotein particles during uncoating. PMID: 19776119
