Recombinant Vaejovis Mexicanus Smithi Potassium Channel Toxin Alpha-Ktx 21.1 Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-09048P
Greater than 90% as determined by SDS-PAGE.
Recombinant Vaejovis Mexicanus Smithi Potassium Channel Toxin Alpha-Ktx 21.1 Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-09048P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Vaejovis Mexicanus Smithi Potassium Channel Toxin Alpha-Ktx 21.1 Protein (His&Myc) is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P0DJ31 |
| Target Symbol | P0DJ31 |
| Synonyms | Potassium channel toxin alpha-KTx 23.1; Toxin Vm24; Toxin alpha-KTx 21.1 |
| Species | Vaejovis mexicanus smithi (Scorpion) (Vaejovis smithi) |
| Expression System | Mammalian cell |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC |
| Expression Range | 1-36aa |
| Protein Length | Full Length |
| Mol. Weight | 7.9kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Selectively and irreversibly binds (K(d)=2.9 pM) and blocks hKv1.3/KCNA3 potassium channels of human T-lymphocytes. Weakly blocks hKCa3.1/KCNN4, mKv1.1/KCNA1, and hKv1.2/KCNA2 channels. In vivo, high doses (200 ug) produce no symptoms of intoxication when injected into mice. |
| Subcellular Location | Secreted. |
| Protein Families | Short scorpion toxin superfamily, Potassium channel inhibitor family, Alpha-KTx 23 subfamily |
| Tissue Specificity | Expressed by the venom gland. |
